Recombinant Human TUBGCP3 protein, His-tagged
| Cat.No. : | TUBGCP3-3843H |
| Product Overview : | Recombinant Human TUBGCP3 protein(1-350 aa), fused to His tag, was expressed in E. coli. |
| Availability | December 17, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-350 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | MATPDQKSPNVLLQNLCCRILGRSEADVAQQFQYAVRVIGSNFAPTVERDEFLVAEKIKKELIRQRREADAALFSELHRKLHSQGVLKNKWSILYLLLSLSEDPRRQPSKVSSYATLFAQALPRDAHSTPYYYARPQTLPLSYQDRSAQSAQSSGSVGSSGISSIGLCALSGPAPAPQSLLPGQSNQAPGVGDCLRQQLGSRLAWTLTANQPSSQATTSKGVPSAVSRNMTRSRREGDTGGTMEITEAALVRDILYVFQGIDGKNIKMNNTENCYKVEGKANLSRSLRDTAVRLSELGWLHNKIRRYTDQRSLDRSFGLVGQSFCAALHQELREYYRLLSVLHSQLQLED |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | TUBGCP3 tubulin, gamma complex associated protein 3 [ Homo sapiens ] |
| Official Symbol | TUBGCP3 |
| Synonyms | TUBGCP3; tubulin, gamma complex associated protein 3; gamma-tubulin complex component 3; GCP3; SPBC98; Spc98p; spindle pole body protein; GCP-3; h104p; hGCP3; hSpc98; hGrip104; gamma-ring complex protein 104 kDa; spindle pole body protein Spc98 homolog; |
| Gene ID | 10426 |
| mRNA Refseq | NM_006322 |
| Protein Refseq | NP_006313 |
| UniProt ID | Q96CW5 |
| ◆ Recombinant Proteins | ||
| TUBGCP3-16H | Recombinant Human TUBGCP3 protein, GST-tagged | +Inquiry |
| TUBGCP3-9766M | Recombinant Mouse TUBGCP3 Protein, His (Fc)-Avi-tagged | +Inquiry |
| Tubgcp3-6733M | Recombinant Mouse Tubgcp3 Protein, Myc/DDK-tagged | +Inquiry |
| TUBGCP3-9057HFL | Recombinant Full Length Human TUBGCP3 protein, Flag-tagged | +Inquiry |
| TUBGCP3-12H | Recombinant Human TUBGCP3 protein, MYC/DDK-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| TUBGCP3-641HCL | Recombinant Human TUBGCP3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TUBGCP3 Products
Required fields are marked with *
My Review for All TUBGCP3 Products
Required fields are marked with *
