Recombinant Human TULP3 protein, GST-tagged
| Cat.No. : | TULP3-301433H |
| Product Overview : | Recombinant Human TULP3 (96-442 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | Asp96-Glu442 |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| AA Sequence : | DEVHAPSVSSSVVEEDAENTVDTASKPGLQERLQKHDISESVNFDEETDGISQSACLERPNSASSQNSTDTGTSGSATAAQPADNLLGDIDYLEDFVYSPAPQGVTVRCRIIRDKRGMDRGLFPTYYMYLEKEENQKIFLLAARKRKKSKTANYLISIDPVDLSREGESYVGKLRSNLMGTKFTVYDRGICPMKGRGLVGAAHTRQELAAISYETNVLGFKGPRKMSVIIPGMTLNHKQIPYQPQNNHDSLLSRWQNRTMENLVELHNKAPVWNSDTQSYVLNFRGRVTQASVKNFQIVHKNDPDYIVMQFGRVADDVFTLDYNYPLCAVQAFGIGLSSFDSKLACE |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Gene Name | TULP3 tubby like protein 3 [ Homo sapiens ] |
| Official Symbol | TULP3 |
| Synonyms | TULP3; tub; tubby-related protein 3; TUBL3; tubby-like protein 3; MGC45295; |
| Gene ID | 7289 |
| mRNA Refseq | NM_001160408 |
| Protein Refseq | NP_001153880 |
| MIM | 604730 |
| UniProt ID | O75386 |
| ◆ Recombinant Proteins | ||
| TULP3-5029R | Recombinant Rhesus monkey TULP3 Protein, His-tagged | +Inquiry |
| TULP3-01HFL | Recombinant Full Length Human TULP3 Protein, GST tagged | +Inquiry |
| TULP3-9772M | Recombinant Mouse TULP3 Protein, His (Fc)-Avi-tagged | +Inquiry |
| TULP3-17635M | Recombinant Mouse TULP3 Protein | +Inquiry |
| TULP3-4842R | Recombinant Rhesus Macaque TULP3 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| TULP3-638HCL | Recombinant Human TULP3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TULP3 Products
Required fields are marked with *
My Review for All TULP3 Products
Required fields are marked with *



