Recombinant Human TULP3 protein, GST-tagged
Cat.No. : | TULP3-301433H |
Product Overview : | Recombinant Human TULP3 (96-442 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | Asp96-Glu442 |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | DEVHAPSVSSSVVEEDAENTVDTASKPGLQERLQKHDISESVNFDEETDGISQSACLERPNSASSQNSTDTGTSGSATAAQPADNLLGDIDYLEDFVYSPAPQGVTVRCRIIRDKRGMDRGLFPTYYMYLEKEENQKIFLLAARKRKKSKTANYLISIDPVDLSREGESYVGKLRSNLMGTKFTVYDRGICPMKGRGLVGAAHTRQELAAISYETNVLGFKGPRKMSVIIPGMTLNHKQIPYQPQNNHDSLLSRWQNRTMENLVELHNKAPVWNSDTQSYVLNFRGRVTQASVKNFQIVHKNDPDYIVMQFGRVADDVFTLDYNYPLCAVQAFGIGLSSFDSKLACE |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Gene Name | TULP3 tubby like protein 3 [ Homo sapiens ] |
Official Symbol | TULP3 |
Synonyms | TULP3; tub; tubby-related protein 3; TUBL3; tubby-like protein 3; MGC45295; |
Gene ID | 7289 |
mRNA Refseq | NM_001160408 |
Protein Refseq | NP_001153880 |
MIM | 604730 |
UniProt ID | O75386 |
◆ Recombinant Proteins | ||
Tulp3-6737M | Recombinant Mouse Tulp3 Protein, Myc/DDK-tagged | +Inquiry |
TULP3-1998H | Recombinant Human TULP3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
TULP3-5759HFL | Recombinant Full Length Human TULP3 protein, Flag-tagged | +Inquiry |
TULP3-17635M | Recombinant Mouse TULP3 Protein | +Inquiry |
TULP3-213H | Recombinant Human TULP3 protein, MYC/DDK-tagged | +Inquiry |
◆ Native Proteins | ||
TULP3-01HFL | Recombinant Full Length Human TULP3 Protein, GST tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TULP3-638HCL | Recombinant Human TULP3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TULP3 Products
Required fields are marked with *
My Review for All TULP3 Products
Required fields are marked with *
0
Inquiry Basket