Recombinant Human TWSG1 protein, His-tagged
Cat.No. : | TWSG1-3783H |
Product Overview : | Recombinant Human TWSG1 protein(14-223 aa), fused to His tag, was expressed in E. coli. |
Availability | May 21, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 14-223 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | LMFLTWLPESLSCNKALCASDVSKCLIQELCQCRPGEGNCSCCKECMLCLGALWDECCDCVGMCNPRNYSDTPPTSKSTVEELHEPIPSLFRALTEGDTQLNWNIVSFPVAEELSHHENLVSFLETVNQPHHQNVSVPSNNVHAPYSSDKEHMCTVVYFDDCMSIHQCKISCESMGASKYRWFHNACCECIGPECIDYGSKTVKCMNCMF |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | TWSG1 twisted gastrulation homolog 1 (Drosophila) [ Homo sapiens ] |
Official Symbol | TWSG1 |
Synonyms | TWSG1; twisted gastrulation homolog 1 (Drosophila); twisted gastrulation protein homolog 1; TSG; |
Gene ID | 57045 |
mRNA Refseq | NM_020648 |
Protein Refseq | NP_065699 |
MIM | 605049 |
UniProt ID | Q9GZX9 |
◆ Recombinant Proteins | ||
Twsg1-514M | Active Recombinant Mouse Twsg1, His-tagged | +Inquiry |
TWSG1-5035R | Recombinant Rhesus monkey TWSG1 Protein, His-tagged | +Inquiry |
Twsg1-850M | Recombinant Mouse Twsg1 Protein, His-tagged | +Inquiry |
TWSG1-2975H | Recombinant Human TWSG1 Protein | +Inquiry |
TWSG1-1506H | Recombinant Human Twisted Gastrulation Homolog 1 (Drosophila) | +Inquiry |
◆ Cell & Tissue Lysates | ||
TWSG1-1547MCL | Recombinant Mouse TWSG1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TWSG1 Products
Required fields are marked with *
My Review for All TWSG1 Products
Required fields are marked with *
0
Inquiry Basket