Recombinant Human TXLNA Protein, His-tagged
Cat.No. : | TXLNA-358H |
Product Overview : | Recombinant Human TXLNA protein(Met1-Lys162), fused with N-terminal His tag and C-terminal His tag, was expressed in E. coli. |
Availability | April 30, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | Met1-Lys162 |
Tag : | N-His&C-His |
Form : | Liquid in sterile PBS, pH7.4. |
Molecular Mass : | The protein has a calculated MW of 20 kDa. |
Endotoxin : | <1.0EU per 1μg (determined by the LAL method). |
Purity : | > 90 % as determined by SDS-PAGE. |
Storage : | Store it under sterile conditions at -80°C. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Concentration : | 0.63 mg/ml. Centrifuge the vial at 4°C before opening to recover the entire contents. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | MGSSHHHHHHHHSSGLVPRGSMKNQDKKNGAAKQSNPKSSPGQPEAGPEGAQERPSQAAPAVEAEGPGSSQAPRKPEGAQARTAQSGALRDVSEELSRQLEDILSTYCVDNNQGGPGEDGAQGEPAEPEDAEKSRTYVARNGEPEPTPVVNGEKEPSKGDPNTEEIRQSDEVGDRDHRRPQEKHHHHHH |
Gene Name | TXLNA taxilin alpha [ Homo sapiens ] |
Official Symbol | TXLNA |
Synonyms | TXLNA; taxilin alpha; alpha-taxilin; DKFZp451J0118; interleukin 14; IL14; TXLN; RP4-622L5.4; MGC118870; MGC118871; |
Gene ID | 200081 |
mRNA Refseq | NM_175852 |
Protein Refseq | NP_787048 |
MIM | 608676 |
UniProt ID | P40222 |
◆ Recombinant Proteins | ||
TXLNA-303HFL | Recombinant Full Length Human TXLNA Protein, C-Flag-tagged | +Inquiry |
TXLNA-5735Z | Recombinant Zebrafish TXLNA | +Inquiry |
TXLNA-2892H | Recombinant Human TXLNA protein, His-tagged | +Inquiry |
Txlna-425M | Recombinant Mouse Txlna Protein, MYC/DDK-tagged | +Inquiry |
Txlna-5779M | Recombinant Mouse Txlna protein, His & GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TXLNA-629HCL | Recombinant Human TXLNA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TXLNA Products
Required fields are marked with *
My Review for All TXLNA Products
Required fields are marked with *
0
Inquiry Basket