Recombinant Human TXLNA Protein, His-tagged

• Cat.No.: TXLNA-358H
• Product Overview: Recombinant Human TXLNA protein(Met1-Lys162), fused with N-terminal His tag and C-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: Met1-Lys162
• Tag: N-His&C-His
• Form: Liquid in sterile PBS, pH7.4.
• Molecular Mass: The protein has a calculated MW of 20 kDa.
• Endotoxin: <1.0EU per 1μg (determined by the LAL method).
• Purity: > 90 % as determined by SDS-PAGE.
• Storage: Store it under sterile conditions at -80°C. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Concentration: 0.63 mg/ml. Centrifuge the vial at 4°C before opening to recover the entire contents.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
• AA Sequence: MGSSHHHHHHHHSSGLVPRGSMKNQDKKNGAAKQSNPKSSPGQPEAGPEGAQERPSQAAPAVEAEGPGSSQAPRKPEGAQARTAQSGALRDVSEELSRQLEDILSTYCVDNNQGGPGEDGAQGEPAEPEDAEKSRTYVARNGEPEPTPVVNGEKEPSKGDPNTEEIRQSDEVGDRDHRRPQEKHHHHHH

Gene Information

• Gene Name: TXLNA taxilin alpha [ Homo sapiens ]
• Official Symbol: TXLNA
• Synonyms: TXLNA; taxilin alpha; alpha-taxilin; DKFZp451J0118; interleukin 14; IL14; TXLN; RP4-622L5.4; MGC118870; MGC118871
• Gene ID: 200081
• mRNA Refseq: NM_175852
• Protein Refseq: NP_787048
• MIM: 608676
• UniProt ID: P40222