Recombinant Human TXLNA Protein, His-tagged

Cat.No. : TXLNA-358H
Product Overview : Recombinant Human TXLNA protein(Met1-Lys162), fused with N-terminal His tag and C-terminal His tag, was expressed in E. coli.
Availability October 01, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : Met1-Lys162
Tag : N-His&C-His
Form : Liquid in sterile PBS, pH7.4.
Molecular Mass : The protein has a calculated MW of 20 kDa.
Endotoxin : <1.0EU per 1μg (determined by the LAL method).
Purity : > 90 % as determined by SDS-PAGE.
Storage : Store it under sterile conditions at -80°C. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Concentration : 0.63 mg/ml. Centrifuge the vial at 4°C before opening to recover the entire contents.
Reconstitution : It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
AA Sequence : MGSSHHHHHHHHSSGLVPRGSMKNQDKKNGAAKQSNPKSSPGQPEAGPEGAQERPSQAAPAVEAEGPGSSQAPRKPEGAQARTAQSGALRDVSEELSRQLEDILSTYCVDNNQGGPGEDGAQGEPAEPEDAEKSRTYVARNGEPEPTPVVNGEKEPSKGDPNTEEIRQSDEVGDRDHRRPQEKHHHHHH
Gene Name TXLNA taxilin alpha [ Homo sapiens ]
Official Symbol TXLNA
Synonyms TXLNA; taxilin alpha; alpha-taxilin; DKFZp451J0118; interleukin 14; IL14; TXLN; RP4-622L5.4; MGC118870; MGC118871;
Gene ID 200081
mRNA Refseq NM_175852
Protein Refseq NP_787048
MIM 608676
UniProt ID P40222

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TXLNA Products

Required fields are marked with *

My Review for All TXLNA Products

Required fields are marked with *

0
cart-icon
0
compare icon