Recombinant Human TXNIP protein, GST-tagged
| Cat.No. : | TXNIP-3645H |
| Product Overview : | Recombinant Human TXNIP protein(59 - 206 aa), fused to GST tag, was expressed in E. coli. |
| Availability | December 27, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 59 - 206 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH. |
| AA Sequence : | GSQQCKQTSEYLRYEDTLLLEDQPTGENEMVIMRPGNKYEYKFGFELPQGPLGTSFKGKYGCVDYWVKAFLDRPSQPTQETKKNFEVVDLVDVNTPDLMAPVSAKKEKKVSCMFIPDGRVSVSARIDRKGFCEGDEISIHADFENTCS |
| Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | TXNIP thioredoxin interacting protein [ Homo sapiens ] |
| Official Symbol | TXNIP |
| Synonyms | TXNIP; thioredoxin interacting protein; thioredoxin-interacting protein; EST01027; HHCPA78; THIF; thioredoxin binding protein 2; upregulated by 1; 25 dihydroxyvitamin D 3; VDUP1; thioredoxin-binding protein 2; vitamin D3 up-regulated protein 1; upregulated by 1,25-dihydroxyvitamin D-3; |
| Gene ID | 10628 |
| mRNA Refseq | NM_006472 |
| Protein Refseq | NP_006463 |
| MIM | 606599 |
| UniProt ID | Q9H3M7 |
| ◆ Recombinant Proteins | ||
| TXNIP-4853R | Recombinant Rhesus Macaque TXNIP Protein, His (Fc)-Avi-tagged | +Inquiry |
| TXNIP-5568H | Recombinant Human TXNIP Protein (Ile32-Ala367), N-His tagged | +Inquiry |
| TXNIP-449HFL | Recombinant Full Length Human TXNIP Protein, C-Flag-tagged | +Inquiry |
| TXNIP-17663M | Recombinant Mouse TXNIP Protein | +Inquiry |
| TXNIP-2283H | Recombinant Human TXNIP Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| TXNIP-620HCL | Recombinant Human TXNIP 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TXNIP Products
Required fields are marked with *
My Review for All TXNIP Products
Required fields are marked with *
