Recombinant Human TXNL4A protein, His-tagged

Cat.No. : TXNL4A-3795H
Product Overview : Recombinant Human TXNL4A protein(1-142 aa), fused with N-terminal His tag, was expressed in E. coli.
Availability December 27, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 1-142 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
AA Sequence : MSYMLPHLHNGWQVDQAILSEEDRVVVIRFGHDWDPTCMKMDEVLYSIAEKVKNFAVIYLVDITEVPDFNKMYELYDPCTVMFFFRNKHIMIDLGTGNNNKINWAMEDKQEMVDIIETVYRGARKGRGLVVSPKDYSTKYRY
Purity : 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Official Symbol TXNL4A
Synonyms TXNL4A; thioredoxin-like 4A; thioredoxin like 4 , TXNL4; thioredoxin-like protein 4A; DIB1; DIM1; HsT161; similar to S. pombe dim1+; U5 15kD; thioredoxin-like 4; DIM1 protein homolog; thioredoxin-like U5 snRNP protein U5-15kD; spliceosomal U5 snRNP-specific 15 kDa protein; TXNL4; U5-15kD;
Gene ID 10907
mRNA Refseq NM_006701
Protein Refseq NP_006692
MIM 611595
UniProt ID P83876

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TXNL4A Products

Required fields are marked with *

My Review for All TXNL4A Products

Required fields are marked with *

0
cart-icon
0
compare icon