Recombinant Human TXNL4A protein, His-tagged
| Cat.No. : | TXNL4A-3795H |
| Product Overview : | Recombinant Human TXNL4A protein(1-142 aa), fused with N-terminal His tag, was expressed in E. coli. |
| Availability | December 27, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-142 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| AA Sequence : | MSYMLPHLHNGWQVDQAILSEEDRVVVIRFGHDWDPTCMKMDEVLYSIAEKVKNFAVIYLVDITEVPDFNKMYELYDPCTVMFFFRNKHIMIDLGTGNNNKINWAMEDKQEMVDIIETVYRGARKGRGLVVSPKDYSTKYRY |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Official Symbol | TXNL4A |
| Synonyms | TXNL4A; thioredoxin-like 4A; thioredoxin like 4 , TXNL4; thioredoxin-like protein 4A; DIB1; DIM1; HsT161; similar to S. pombe dim1+; U5 15kD; thioredoxin-like 4; DIM1 protein homolog; thioredoxin-like U5 snRNP protein U5-15kD; spliceosomal U5 snRNP-specific 15 kDa protein; TXNL4; U5-15kD; |
| Gene ID | 10907 |
| mRNA Refseq | NM_006701 |
| Protein Refseq | NP_006692 |
| MIM | 611595 |
| UniProt ID | P83876 |
| ◆ Recombinant Proteins | ||
| TXNL4A-4855R | Recombinant Rhesus Macaque TXNL4A Protein, His (Fc)-Avi-tagged | +Inquiry |
| TXNL4A-6772H | Recombinant Human Thioredoxin-like 4A, His-tagged | +Inquiry |
| TXNL4A-3795H | Recombinant Human TXNL4A protein, His-tagged | +Inquiry |
| TXNL4A-17665M | Recombinant Mouse TXNL4A Protein | +Inquiry |
| TXNL4A-5042R | Recombinant Rhesus monkey TXNL4A Protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| TXNL4A-618HCL | Recombinant Human TXNL4A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TXNL4A Products
Required fields are marked with *
My Review for All TXNL4A Products
Required fields are marked with *
