Recombinant Human TXNL4B, His-tagged
| Cat.No. : | TXNL4B-31638TH |
| Product Overview : | Recombinant full length Human TXNL4B with an N terminal His tag; 185 amino acids with tag, MWt 21.1 kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 149 amino acids |
| Description : | Thioredoxin-like 4B is a protein that is encoded by the TXNL4B gene. |
| Conjugation : | HIS |
| Molecular Weight : | 21.100kDa inclusive of tags |
| Form : | Liquid |
| Purity : | >90% by SDS-PAGE |
| Storage buffer : | Preservative: NoneConstituents: 30% Glycerol, 20mM Tris HCl, 100mM Sodium chloride, 1mM DTT, pH 8.0 |
| Storage : | Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
| Sequences of amino acids : | MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDRWGSMSFLLPKLTSKKEVDQAIKSTAEKVLVLRFGRDEDPVCLQLDDILSKTSSDLSKMAAIYLVDVDQTAVYTQYFDISYIPSTVFFFNGQHMKVDYGSPDHTKFVGSFKTKQDFIDLIEVIYRGAMRGKLIVQSPIDPKNIPKYDLLYQDI |
| Sequence Similarities : | Belongs to the DIM1 family. |
| Gene Name | TXNL4B thioredoxin-like 4B [ Homo sapiens ] |
| Official Symbol | TXNL4B |
| Synonyms | TXNL4B; thioredoxin-like 4B; thioredoxin-like protein 4B; Dim2; DLP; FLJ20511; |
| Gene ID | 54957 |
| mRNA Refseq | NM_017853 |
| Protein Refseq | NP_060323 |
| Uniprot ID | Q9NX01 |
| Chromosome Location | 16q22.2 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TXNL4B Products
Required fields are marked with *
My Review for All TXNL4B Products
Required fields are marked with *



