Recombinant Human TXNL4B, His-tagged
Cat.No. : | TXNL4B-31638TH |
Product Overview : | Recombinant full length Human TXNL4B with an N terminal His tag; 185 amino acids with tag, MWt 21.1 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 149 amino acids |
Description : | Thioredoxin-like 4B is a protein that is encoded by the TXNL4B gene. |
Conjugation : | HIS |
Molecular Weight : | 21.100kDa inclusive of tags |
Form : | Liquid |
Purity : | >90% by SDS-PAGE |
Storage buffer : | Preservative: NoneConstituents: 30% Glycerol, 20mM Tris HCl, 100mM Sodium chloride, 1mM DTT, pH 8.0 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
Sequences of amino acids : | MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDRWGSMSFLLPKLTSKKEVDQAIKSTAEKVLVLRFGRDEDPVCLQLDDILSKTSSDLSKMAAIYLVDVDQTAVYTQYFDISYIPSTVFFFNGQHMKVDYGSPDHTKFVGSFKTKQDFIDLIEVIYRGAMRGKLIVQSPIDPKNIPKYDLLYQDI |
Sequence Similarities : | Belongs to the DIM1 family. |
Gene Name | TXNL4B thioredoxin-like 4B [ Homo sapiens ] |
Official Symbol | TXNL4B |
Synonyms | TXNL4B; thioredoxin-like 4B; thioredoxin-like protein 4B; Dim2; DLP; FLJ20511; |
Gene ID | 54957 |
mRNA Refseq | NM_017853 |
Protein Refseq | NP_060323 |
Uniprot ID | Q9NX01 |
Chromosome Location | 16q22.2 |
◆ Recombinant Proteins | ||
TXNL4B-5043R | Recombinant Rhesus monkey TXNL4B Protein, His-tagged | +Inquiry |
TXNL4B-4856R | Recombinant Rhesus Macaque TXNL4B Protein, His (Fc)-Avi-tagged | +Inquiry |
TXNL4B-4025H | Recombinant Human TXNL4B protein, His-tagged | +Inquiry |
Txnl4b-6753M | Recombinant Mouse Txnl4b Protein, Myc/DDK-tagged | +Inquiry |
TXNL4B-546H | Recombinant Human TXNL4B protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TXNL4B-617HCL | Recombinant Human TXNL4B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TXNL4B Products
Required fields are marked with *
My Review for All TXNL4B Products
Required fields are marked with *