Recombinant Human TXNL4B, His-tagged

Cat.No. : TXNL4B-31638TH
Product Overview : Recombinant full length Human TXNL4B with an N terminal His tag; 185 amino acids with tag, MWt 21.1 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 149 amino acids
Description : Thioredoxin-like 4B is a protein that is encoded by the TXNL4B gene.
Conjugation : HIS
Molecular Weight : 21.100kDa inclusive of tags
Form : Liquid
Purity : >90% by SDS-PAGE
Storage buffer : Preservative: NoneConstituents: 30% Glycerol, 20mM Tris HCl, 100mM Sodium chloride, 1mM DTT, pH 8.0
Storage : Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids : MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDRWGSMSFLLPKLTSKKEVDQAIKSTAEKVLVLRFGRDEDPVCLQLDDILSKTSSDLSKMAAIYLVDVDQTAVYTQYFDISYIPSTVFFFNGQHMKVDYGSPDHTKFVGSFKTKQDFIDLIEVIYRGAMRGKLIVQSPIDPKNIPKYDLLYQDI
Sequence Similarities : Belongs to the DIM1 family.
Gene Name TXNL4B thioredoxin-like 4B [ Homo sapiens ]
Official Symbol TXNL4B
Synonyms TXNL4B; thioredoxin-like 4B; thioredoxin-like protein 4B; Dim2; DLP; FLJ20511;
Gene ID 54957
mRNA Refseq NM_017853
Protein Refseq NP_060323
Uniprot ID Q9NX01
Chromosome Location 16q22.2

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TXNL4B Products

Required fields are marked with *

My Review for All TXNL4B Products

Required fields are marked with *

0
cart-icon
0
compare icon