Recombinant Human TYR protein(281-360 aa), C-His-tagged

Cat.No. : TYR-2655H
Product Overview : Recombinant Human TYR protein(P14679)(281-360 aa), fused with C-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 281-360 aa
Form : 0.15 M Phosphate buffered saline
Storage : Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
Up to 12 months when aliquoted and stored at -20 to -80°C.
Reconstitution : It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
AA Sequence : EYNSHQSLCNGTPEGPLRRNPGNHDKSRTPRLPSSADVEFCLSLTQYESGSMDKAANFSFRNTLEGFASPLTGIADASQS
Gene Name TYR tyrosinase (oculocutaneous albinism IA) [ Homo sapiens ]
Official Symbol TYR
Synonyms TYR; tyrosinase (oculocutaneous albinism IA); tyrosinase; OCAIA; LB24-AB; SK29-AB; monophenol monooxygenase; tumor rejection antigen AB; CMM8; OCA1A; SHEP3;
Gene ID 7299
mRNA Refseq NM_000372
Protein Refseq NP_000363
MIM 606933
UniProt ID P14679

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TYR Products

Required fields are marked with *

My Review for All TYR Products

Required fields are marked with *

0
cart-icon
0
compare icon