Recombinant Human TYR protein(281-360 aa), C-His-tagged
| Cat.No. : | TYR-2655H |
| Product Overview : | Recombinant Human TYR protein(P14679)(281-360 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 281-360 aa |
| Form : | 0.15 M Phosphate buffered saline |
| Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| AA Sequence : | EYNSHQSLCNGTPEGPLRRNPGNHDKSRTPRLPSSADVEFCLSLTQYESGSMDKAANFSFRNTLEGFASPLTGIADASQS |
| Gene Name | TYR tyrosinase (oculocutaneous albinism IA) [ Homo sapiens ] |
| Official Symbol | TYR |
| Synonyms | TYR; tyrosinase (oculocutaneous albinism IA); tyrosinase; OCAIA; LB24-AB; SK29-AB; monophenol monooxygenase; tumor rejection antigen AB; CMM8; OCA1A; SHEP3; |
| Gene ID | 7299 |
| mRNA Refseq | NM_000372 |
| Protein Refseq | NP_000363 |
| MIM | 606933 |
| UniProt ID | P14679 |
| ◆ Recombinant Proteins | ||
| TYR-5736C | Recombinant Chicken TYR | +Inquiry |
| TYR-17673M | Recombinant Mouse TYR Protein | +Inquiry |
| TYR-8643Z | Recombinant Zebrafish TYR | +Inquiry |
| TYR-286P | Recombinant Pig TYR Protein, His-tagged | +Inquiry |
| TYR-9798M | Recombinant Mouse TYR Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| TYR-1869HCL | Recombinant Human TYR cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TYR Products
Required fields are marked with *
My Review for All TYR Products
Required fields are marked with *
