Recombinant Human UBAC2 protein, His-tagged
Cat.No. : | UBAC2-141H |
Product Overview : | Recombinant Human UBAC2 protein(NP_001137544)(18-231 aa), fused to His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 18-231 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.). 5 % trehalose and 5 % mannitol are added as protectants before lyophilization. |
AA Sequence : | LAPVFALFVPFYCSIPRVQVAQILGPLSITNKTLIYILGLQLFTSGSYIWIVAISGLMSGLCYDSKMFQVHQVLCIPSWMAKFFSWTLEPIFSSSEPTSEARIGMGATLDIQRQQRMELLDRQLMFSQFAQGRRQRQQQGGMINWNRLFPPLRQRQNVNYQGGRQSEPAAPPLEVSEEQVARLMEMGFSRGDALEALRASNNDLNVATNFLLQH |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | UBAC2 UBA domain containing 2 [ Homo sapiens ] |
Official Symbol | UBAC2 |
Synonyms | UBAC2; UBA domain containing 2; PHGDHL1, phosphoglycerate dehydrogenase like 1; ubiquitin-associated domain-containing protein 2; FLJ30548; RP11 178C10.1; RP11-178C10.1; UBA domain-containing protein 2; phosphoglycerate dehydrogenase like 1; phosphoglycerate dehydrogenase-like protein 1; PHGDHL1; FLJ26351; FLJ30001; FLJ42413; MGC90487; |
Gene ID | 337867 |
mRNA Refseq | NM_001144072 |
Protein Refseq | NP_001137544 |
UniProt ID | Q8NBM4 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All UBAC2 Products
Required fields are marked with *
My Review for All UBAC2 Products
Required fields are marked with *
0
Inquiry Basket