Recombinant Human UBAC2 protein, His-tagged

Cat.No. : UBAC2-141H
Product Overview : Recombinant Human UBAC2 protein(NP_001137544)(18-231 aa), fused to His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 18-231 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.). 5 % trehalose and 5 % mannitol are added as protectants before lyophilization.
AA Sequence : LAPVFALFVPFYCSIPRVQVAQILGPLSITNKTLIYILGLQLFTSGSYIWIVAISGLMSGLCYDSKMFQVHQVLCIPSWMAKFFSWTLEPIFSSSEPTSEARIGMGATLDIQRQQRMELLDRQLMFSQFAQGRRQRQQQGGMINWNRLFPPLRQRQNVNYQGGRQSEPAAPPLEVSEEQVARLMEMGFSRGDALEALRASNNDLNVATNFLLQH
Purity : 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name UBAC2 UBA domain containing 2 [ Homo sapiens ]
Official Symbol UBAC2
Synonyms UBAC2; UBA domain containing 2; PHGDHL1, phosphoglycerate dehydrogenase like 1; ubiquitin-associated domain-containing protein 2; FLJ30548; RP11 178C10.1; RP11-178C10.1; UBA domain-containing protein 2; phosphoglycerate dehydrogenase like 1; phosphoglycerate dehydrogenase-like protein 1; PHGDHL1; FLJ26351; FLJ30001; FLJ42413; MGC90487;
Gene ID 337867
mRNA Refseq NM_001144072
Protein Refseq NP_001137544
UniProt ID Q8NBM4

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All UBAC2 Products

Required fields are marked with *

My Review for All UBAC2 Products

Required fields are marked with *

0
cart-icon
0
compare icon