Recombinant Human UBD, His-tagged
Cat.No. : | UBD-28355TH |
Product Overview : | Recombinant full-length Human Diubiquitin with a N terminal His tag. 188 amino acids with a predicted MWt 20.9 kDa including tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 165 amino acids |
Description : | Universal Publishers produce the ubiquitous UBD and Gregorys street directories in Australia. The names of these publications have come to be used as a generic term for street directories in many Australian cities. |
Conjugation : | HIS |
Molecular Weight : | 20.900kDa inclusive of tags |
Tissue specificity : | Constitutively expressed in mature dendritic cells and B cells. Mostly expressed in the reticuloendothelial system (e.g. thymus, spleen), the gastrointestinal system, kidney, lung and prostate gland. |
Form : | Liquid |
Purity : | >90% by SDS-PAGE |
Storage buffer : | pH: 8.00Constituents:0.32% Tris HCl, 40% Glycerol, 0.88% Sodium chloride, 0.02% DTT |
Storage : | Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMGSMAPNASCLCVHVRSEEWDLMTFDANPYDSVKKIKEHVRSKTKVPVQDQVLLLGSKILKPRRSLSSYGIDKEKTIHLTLKVVKPSDEELPLFLVESGDEAKRHLLQVRRSSSVAQVKAMIETKTGIIPETQIVTCNGKRLEDGKMMADYGIRKGNLLFLACYCIGG |
Sequence Similarities : | Contains 2 ubiquitin-like domains. |
Gene Name | UBD ubiquitin D [ Homo sapiens ] |
Official Symbol | UBD |
Synonyms | UBD; ubiquitin D; FAT10; |
Gene ID | 10537 |
mRNA Refseq | NM_006398 |
Protein Refseq | NP_006389 |
MIM | 606050 |
Uniprot ID | O15205 |
Chromosome Location | 6p21.3 |
Function | proteasome binding; protein binding; |
◆ Recombinant Proteins | ||
UBD-938H | Active Recombinant Human UBD | +Inquiry |
UBD-936H | Recombinant Human UBD Protein, His-tagged | +Inquiry |
UBD-6392R | Recombinant Rat UBD Protein | +Inquiry |
Ubd-1736R | Recombinant Rat Ubd protein, His & T7-tagged | +Inquiry |
UBD-7866H | Recombinant Human UBD protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
UBD-596HCL | Recombinant Human UBD 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All UBD Products
Required fields are marked with *
My Review for All UBD Products
Required fields are marked with *
0
Inquiry Basket