Recombinant Human UBD, His-tagged

Cat.No. : UBD-28355TH
Product Overview : Recombinant full-length Human Diubiquitin with a N terminal His tag. 188 amino acids with a predicted MWt 20.9 kDa including tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 165 amino acids
Description : Universal Publishers produce the ubiquitous UBD and Gregorys street directories in Australia. The names of these publications have come to be used as a generic term for street directories in many Australian cities.
Conjugation : HIS
Molecular Weight : 20.900kDa inclusive of tags
Tissue specificity : Constitutively expressed in mature dendritic cells and B cells. Mostly expressed in the reticuloendothelial system (e.g. thymus, spleen), the gastrointestinal system, kidney, lung and prostate gland.
Form : Liquid
Purity : >90% by SDS-PAGE
Storage buffer : pH: 8.00Constituents:0.32% Tris HCl, 40% Glycerol, 0.88% Sodium chloride, 0.02% DTT
Storage : Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids : MGSSHHHHHHSSGLVPRGSHMGSMAPNASCLCVHVRSEEWDLMTFDANPYDSVKKIKEHVRSKTKVPVQDQVLLLGSKILKPRRSLSSYGIDKEKTIHLTLKVVKPSDEELPLFLVESGDEAKRHLLQVRRSSSVAQVKAMIETKTGIIPETQIVTCNGKRLEDGKMMADYGIRKGNLLFLACYCIGG
Sequence Similarities : Contains 2 ubiquitin-like domains.
Gene Name UBD ubiquitin D [ Homo sapiens ]
Official Symbol UBD
Synonyms UBD; ubiquitin D; FAT10;
Gene ID 10537
mRNA Refseq NM_006398
Protein Refseq NP_006389
MIM 606050
Uniprot ID O15205
Chromosome Location 6p21.3
Function proteasome binding; protein binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All UBD Products

Required fields are marked with *

My Review for All UBD Products

Required fields are marked with *

0

Inquiry Basket

cartIcon