Recombinant Human UBD, His-tagged
| Cat.No. : | UBD-28355TH |
| Product Overview : | Recombinant full-length Human Diubiquitin with a N terminal His tag. 188 amino acids with a predicted MWt 20.9 kDa including tag. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 165 amino acids |
| Description : | Universal Publishers produce the ubiquitous UBD and Gregorys street directories in Australia. The names of these publications have come to be used as a generic term for street directories in many Australian cities. |
| Conjugation : | HIS |
| Molecular Weight : | 20.900kDa inclusive of tags |
| Tissue specificity : | Constitutively expressed in mature dendritic cells and B cells. Mostly expressed in the reticuloendothelial system (e.g. thymus, spleen), the gastrointestinal system, kidney, lung and prostate gland. |
| Form : | Liquid |
| Purity : | >90% by SDS-PAGE |
| Storage buffer : | pH: 8.00Constituents:0.32% Tris HCl, 40% Glycerol, 0.88% Sodium chloride, 0.02% DTT |
| Storage : | Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
| Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMGSMAPNASCLCVHVRSEEWDLMTFDANPYDSVKKIKEHVRSKTKVPVQDQVLLLGSKILKPRRSLSSYGIDKEKTIHLTLKVVKPSDEELPLFLVESGDEAKRHLLQVRRSSSVAQVKAMIETKTGIIPETQIVTCNGKRLEDGKMMADYGIRKGNLLFLACYCIGG |
| Sequence Similarities : | Contains 2 ubiquitin-like domains. |
| Gene Name | UBD ubiquitin D [ Homo sapiens ] |
| Official Symbol | UBD |
| Synonyms | UBD; ubiquitin D; FAT10; |
| Gene ID | 10537 |
| mRNA Refseq | NM_006398 |
| Protein Refseq | NP_006389 |
| MIM | 606050 |
| Uniprot ID | O15205 |
| Chromosome Location | 6p21.3 |
| Function | proteasome binding; protein binding; |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All UBD Products
Required fields are marked with *
My Review for All UBD Products
Required fields are marked with *



