Recombinant Human UBD protein, GST-tagged
| Cat.No. : | UBD-301272H |
| Product Overview : | Recombinant Human UBD (11-103 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | His11-Leu103 |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| AA Sequence : | HVRSEEWDLMTFDANPYDSVKKIKEHVRSKTKVPVQDQVLLLGSKILKPRRSLSSYGIDKEKTIHLTLKVVKPSDEELPLFLVESGDEAKRHL |
| Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Gene Name | UBD ubiquitin D [ Homo sapiens ] |
| Official Symbol | UBD |
| Synonyms | UBD; ubiquitin D; FAT10; diubiquitin; ubiquitin-like protein FAT10; UBD-3; GABBR1; |
| Gene ID | 10537 |
| mRNA Refseq | NM_006398 |
| Protein Refseq | NP_006389 |
| MIM | 606050 |
| UniProt ID | O15205 |
| ◆ Recombinant Proteins | ||
| UBD-938H | Active Recombinant Human UBD | +Inquiry |
| UBD-301272H | Recombinant Human UBD protein, GST-tagged | +Inquiry |
| Ubd-1736R | Recombinant Rat Ubd protein, His & T7-tagged | +Inquiry |
| UBD-937H | Active Recombinant Human UBD | +Inquiry |
| Ubd-6778M | Recombinant Mouse Ubd Protein, Myc/DDK-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| UBD-596HCL | Recombinant Human UBD 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All UBD Products
Required fields are marked with *
My Review for All UBD Products
Required fields are marked with *
