Recombinant Human UBE2B Protein, His-tagged
Cat.No. : | UBE2B-615H |
Product Overview : | Recombinant Human UBE2B fused with His tag at C-terminal was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
Description : | The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. This enzyme is required for post-replicative DNA damage repair. Its protein sequence is 100% identical to the mouse, rat, and rabbit homologs, which indicates that this enzyme is highly conserved in eukaryotic evolution. |
Form : | Supplied as a 0.2 µM filtered solution of 25mM Tris, pH 7.5 |
Molecular Mass : | 18.3kD |
AA Sequence : | MSTPARRRLMRDFKRLQEDPPVGVSGAPSENNIMQWNAVIFGPEGTPFEDGTFKLVIEFS EEYPNKPPTVRFLSKMFHPNVYADGSICLDILQNRWSPTYDVSSILTSIQSLLDEPNPNS PANSQAAQLYQENKREYEKRVSAIVEQSWNDSLDHHHHHH |
Endotoxin : | Endotoxin level is <0.1 ng/µg of protein (<1EU/µg). |
Purity : | >95% as determined by SDS-PAGE and Coomassie blue staining |
Gene Name | UBE2B ubiquitin-conjugating enzyme E2B [ Homo sapiens ] |
Official Symbol | UBE2B |
Synonyms | UBE2B; ubiquitin-conjugating enzyme E2B; ubiquitin conjugating enzyme E2B (RAD6 homolog); ubiquitin-conjugating enzyme E2 B; HHR6B; RAD6B; UBC2; E2 protein; RAD6 homolog B; ubiquitin-protein ligase B; ubiquitin carrier protein B; ubiquitin-conjugating enzyme E2-17 kDa; ubiquitin-conjugating enzyme E2B (RAD6 homolog); HR6B; E2-17kDa; |
Gene ID | 7320 |
mRNA Refseq | NM_003337 |
Protein Refseq | NP_003328 |
MIM | 179095 |
UniProt ID | P63146 |
◆ Recombinant Proteins | ||
Ube2b-6780M | Recombinant Mouse Ube2b Protein, Myc/DDK-tagged | +Inquiry |
UBE2B-616H | Recombinant Human UBE2B Protein | +Inquiry |
UBE2B-31450TH | Recombinant Human UBE2B protein | +Inquiry |
UBE2B-07H | Recombinant Human Ubiquitin Conjugating Enzyme E2B | +Inquiry |
UBE2B-5054R | Recombinant Rhesus monkey UBE2B Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
UBE2B-593HCL | Recombinant Human UBE2B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All UBE2B Products
Required fields are marked with *
My Review for All UBE2B Products
Required fields are marked with *
0
Inquiry Basket