Recombinant Human UBE2B Protein, His-tagged

Cat.No. : UBE2B-615H
Product Overview : Recombinant Human UBE2B fused with His tag at C-terminal was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : His
Description : The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. This enzyme is required for post-replicative DNA damage repair. Its protein sequence is 100% identical to the mouse, rat, and rabbit homologs, which indicates that this enzyme is highly conserved in eukaryotic evolution.
Form : Supplied as a 0.2 µM filtered solution of 25mM Tris, pH 7.5
Molecular Mass : 18.3kD
AA Sequence : MSTPARRRLMRDFKRLQEDPPVGVSGAPSENNIMQWNAVIFGPEGTPFEDGTFKLVIEFS EEYPNKPPTVRFLSKMFHPNVYADGSICLDILQNRWSPTYDVSSILTSIQSLLDEPNPNS PANSQAAQLYQENKREYEKRVSAIVEQSWNDSLDHHHHHH
Endotoxin : Endotoxin level is <0.1 ng/µg of protein (<1EU/µg).
Purity : >95% as determined by SDS-PAGE and Coomassie blue staining
Gene Name UBE2B ubiquitin-conjugating enzyme E2B [ Homo sapiens ]
Official Symbol UBE2B
Synonyms UBE2B; ubiquitin-conjugating enzyme E2B; ubiquitin conjugating enzyme E2B (RAD6 homolog); ubiquitin-conjugating enzyme E2 B; HHR6B; RAD6B; UBC2; E2 protein; RAD6 homolog B; ubiquitin-protein ligase B; ubiquitin carrier protein B; ubiquitin-conjugating enzyme E2-17 kDa; ubiquitin-conjugating enzyme E2B (RAD6 homolog); HR6B; E2-17kDa;
Gene ID 7320
mRNA Refseq NM_003337
Protein Refseq NP_003328
MIM 179095
UniProt ID P63146

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All UBE2B Products

Required fields are marked with *

My Review for All UBE2B Products

Required fields are marked with *

0
cart-icon
0
compare icon