Recombinant Human UBE2D1 protein, GST-tagged
Cat.No. : | UBE2D1-005H |
Product Overview : | Recombinant Human UBE2D1 fused with GST tag at N-terminal was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Description : | The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. This enzyme is closely related to a stimulator of iron transport (SFT), and is up-regulated in hereditary hemochromatosis. It also functions in the ubiquitination of the tumor-suppressor protein p53 and the hypoxia-inducible transcription factor HIF1alpha by interacting with the E1 ubiquitin-activating enzyme and the E3 ubiquitin-protein ligases. Two transcript variants encoding different isoforms have been found for this gene. |
Form : | Lyophilized from a 0.2 µM filtered solution of 50mM HEPES,150mM NaCl,2mM DTT,10% Glycerin pH7.5 |
Molecular Mass : | 42.9kD |
AA Sequence : | MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLVPRGSMALKRIQKELSDLQRDPPAHCSAGPVGDD |
Endotoxin : | Endotoxin level is <0.1 ng/µg of protein (<1EU/µg). |
Purity : | >95% as determined by SDS-PAGE and Coomassie blue staining |
Concentration : | Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
Gene Name | UBE2D1 ubiquitin conjugating enzyme E2 D1 [ Homo sapiens (human) ] |
Official Symbol | UBE2D1 |
Synonyms | SFT; UBCH5; UBC4/5; UBCH5A; E2(17)KB1;UBE2D1; |
Gene ID | 7321 |
mRNA Refseq | NM_003338 |
Protein Refseq | NP_003329 |
MIM | 602961 |
UniProt ID | P51668 |
◆ Recombinant Proteins | ||
UBE2D1-005H | Recombinant Human UBE2D1 protein, GST-tagged | +Inquiry |
UBE2D1-850H | Recombinant Human UBE2D1 protein, His-tagged | +Inquiry |
UBE2D1-5055R | Recombinant Rhesus monkey UBE2D1 Protein, His-tagged | +Inquiry |
UBE2D1-120H | Recombinant Human UBE2D1, His-SUMO-tagged | +Inquiry |
UBE2D1-17708M | Recombinant Mouse UBE2D1 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
UBE2D1-589HCL | Recombinant Human UBE2D1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All UBE2D1 Products
Required fields are marked with *
My Review for All UBE2D1 Products
Required fields are marked with *
0
Inquiry Basket