Recombinant Human UBE2D3
| Cat.No. : | UBE2D3-30046TH |
| Product Overview : | Tagged Recombinant Human UBE2D3 |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | Non |
| Description : | The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. This enzyme functions in the ubiquitination of the tumor-suppressor protein p53, which is induced by an E3 ubiquitin-protein ligase. Multiple spliced transcript variants have been found for this gene, but the full-length nature of some variants has not been determined. |
| Form : | Liquid |
| Purity : | >95% by SDS-PAGE |
| Storage buffer : | Preservative: NoneConstituents: 10% Glycerol, 50mM Sodium chloride, 50mM HEPES, 1mM DTT, pH 7.6 |
| Storage : | Aliquot and store at -80°C. Avoid repeated freeze / thaw cycles. |
| Sequences of amino acids : | The sequence (minus the tag) is:MALKRIHKELNDLARDPPAQCSAGPVGDDMFHW QATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTT RIYHPNINSNGSICLDILRSQWSPALTISKVLLSICSLLC DPNPDDPLVPEIARIYKTDREKYNRIAREWTQKYAM |
| Sequence Similarities : | Belongs to the ubiquitin-conjugating enzyme family. |
| Gene Name | UBE2D3 ubiquitin-conjugating enzyme E2D 3 [ Homo sapiens ] |
| Official Symbol | UBE2D3 |
| Synonyms | UBE2D3; ubiquitin-conjugating enzyme E2D 3; ubiquitin conjugating enzyme E2D 3 (homologous to yeast UBC4/5) , ubiquitin conjugating enzyme E2D 3 (UBC4/5 homolog, yeast); ubiquitin-conjugating enzyme E2 D3; UbcH5C; |
| Gene ID | 7323 |
| mRNA Refseq | NM_003340 |
| Protein Refseq | NP_003331 |
| MIM | 602963 |
| Uniprot ID | P61077 |
| Chromosome Location | 4q24 |
| Pathway | Adaptive Immune System, organism-specific biosystem; Antigen processing: Ubiquitination & Proteasome degradation, organism-specific biosystem; BARD1 signaling events, organism-specific biosystem; Canonical NF-kappaB pathway, organism-specific biosystem; |
| Function | ATP binding; acid-amino acid ligase activity; ligase activity; nucleotide binding; protein binding; |
| ◆ Recombinant Proteins | ||
| Ube2d3-6784M | Recombinant Mouse Ube2d3 Protein, Myc/DDK-tagged | +Inquiry |
| UBE2D3-0031H | Recombinant Human UBE2D3 Protein (A2-M147), Tag Free | +Inquiry |
| UBE2D3-2487H | Recombinant Human UBE2D3 protein | +Inquiry |
| UBE2D3-1882H | Recombinant Human UBE2D3 | +Inquiry |
| UBE2D3-0032H | Recombinant Human UBE2D3 Protein (A2-M147), His/Strep tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| UBE2D3-585HCL | Recombinant Human UBE2D3 293 Cell Lysate | +Inquiry |
| UBE2D3-586HCL | Recombinant Human UBE2D3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All UBE2D3 Products
Required fields are marked with *
My Review for All UBE2D3 Products
Required fields are marked with *



