Recombinant Human UBE2D3 protein
Cat.No. : | UBE2D3-2487H |
Product Overview : | Recombinant Human UBE2D3 protein was expressed in Escherichia coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | Non |
Protein Length : | 155 |
Description : | Ubiquitin-conjugating enzyme E2 D3 belongs to the ubiquitin-conjugating enzyme family and is encoded by the UBE2D3 gene in humans. The ubiquitin-conjugating enzymes, also known as E2 enzymes and more rarely as ubiquitin-carrier enzymes, take part in the second step in the ubiquitination reaction. In this reaction, E1 activates the ubiquitin by covalently attaching the molecule to its active site cysteine residue. The activated ubiquitin is then transferred to an E2 cysteine and then the E2 molecule binds E3 via a structurally conserved binding region. The ubiquitination reaction can modify proteins and regulate protein degradation. The UBE2D3 is a human homolog of the yeast UBC4/5 family and play many important regulatory roles in inflammation and cancer. It mediates the degradation of a myriad of short-lived regulatory proteins (such as p53 in the presence of E6/E6-AP or MDM2, c-Fos, IκBα, p105) and abnormal proteins and has 88% and 89% sequence identity with UbcH5a and UbcH5b respectively. |
Form : | 0.2μm Filtered concentrated solution in 50 mM HEPES, pH 6.5, with 125 mM NaCl, 10 % Glycerol, 5 % Trehalose, 1 mM DTT. |
Molecular Mass : | Approximately 17.7 kDa, a single non-glycosylated polypeptide chain containing 147 amino acids (a.a.) of human UBE2D3/UBC5C and 8 a.a. vector sequence including 6 × His tag at N-terminus. |
AA Sequence : | MHHHHHHAMALKRINKELSDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINSNGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDRDKYNRISREWTQKYAM |
Endotoxin : | Less than 1 EU/µg of rHuUBE2D3/UBC5C, His as determined by LAL method. |
Purity : | >95% by SDS-PAGE and HPLC analysis. |
Storage : | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 6 months from date of receipt, -20 to -70 centigrade as supplied. 3 months, -20 to -70 centigrade under sterile conditions after opening. |
Gene Name | UBE2D3 |
Official Symbol | UBE2D3 |
Synonyms | UBE2D3; ubiquitin-conjugating enzyme E2D 3; ubiquitin conjugating enzyme E2D 3 (homologous to yeast UBC4/5) , ubiquitin conjugating enzyme E2D 3 (UBC4/5 homolog, yeast); ubiquitin-conjugating enzyme E2 D3; UbcH5C; E2(17)KB 3; ubiquitin-protein ligase D3; ubiquitin carrier protein D3; ubiquitin-conjugating enzyme E2(17)KB 3; ubiquitin-conjugating enzyme E2-17 kDa 3; ubiquitin-conjugating enzyme E2D 3 (UBC4/5 homolog, yeast); ubiquitin-conjugating enzyme E2D 3 (homologous to yeast UBC4/5); UBC4/5; UBCH5C; E2(17)KB3; MGC5416; MGC43926; |
Gene ID | 7323 |
mRNA Refseq | NM_003340 |
Protein Refseq | NP_003331 |
MIM | 602963 |
UniProt ID | P61077 |
◆ Recombinant Proteins | ||
UBE2D3-205H | Recombinant Human UBE2D3, His-tagged | +Inquiry |
UBE2D3-2566H | Recombinant Human UBE2D3 protein, His-tagged | +Inquiry |
UBE2D3-3643H | Recombinant Human UBE2D3 protein, His-SUMO-tagged | +Inquiry |
UBE2D3-5130H | Recombinant Human UBE2D3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
UBE2D3-0031H | Recombinant Human UBE2D3 Protein (A2-M147), Tag Free | +Inquiry |
◆ Cell & Tissue Lysates | ||
UBE2D3-585HCL | Recombinant Human UBE2D3 293 Cell Lysate | +Inquiry |
UBE2D3-586HCL | Recombinant Human UBE2D3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All UBE2D3 Products
Required fields are marked with *
My Review for All UBE2D3 Products
Required fields are marked with *
0
Inquiry Basket