Recombinant Human UBE2E1 Protein, MYC/DDK-tagged, C13 and N15-labeled

Cat.No. : UBE2E1-174H
Product Overview : UBE2E1 MS Standard C13 and N15-labeled recombinant protein (NP_872607) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. Three alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq, Jan 2011]
Molecular Mass : 19.3 kDa
AA Sequence : MSDDDSRASTSSSSSSSSNQQTEKETNTPKKKESKVSMSKNSKLLSTSAKSAGPKGDNIYEWRSTILGPPGSVYEGGVFFLDITFTPEYPFKPPKVTFRTRIYHCNINSQGVICLDILKDNWSPALTISKVLLSICSLLTDCNPADPLVGSIATQYMTNRAEHDRMARQWTKRYATTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name UBE2E1 ubiquitin conjugating enzyme E2 E1 [ Homo sapiens (human) ]
Official Symbol UBE2E1
Synonyms UBE2E1; ubiquitin conjugating enzyme E2 E1; UBCH6; ubiquitin-conjugating enzyme E2 E1; (E3-independent) E2 ubiquitin-conjugating enzyme E1; E2 ubiquitin-conjugating enzyme E1; ubiquitin carrier protein E1; ubiquitin conjugating enzyme E2E 1; ubiquitin-conjugating enzyme E2E 1 (UBC4/5 homolog, yeast); ubiquitin-conjugating enzyme E2E 1 (homologous to yeast UBC4/5); ubiquitin-protein ligase E1; EC 2.3.2.23; EC 2.3.2.24
Gene ID 7324
mRNA Refseq NM_182666
Protein Refseq NP_872607
MIM 602916
UniProt ID P51965

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All UBE2E1 Products

Required fields are marked with *

My Review for All UBE2E1 Products

Required fields are marked with *

0
cart-icon
0
compare icon