Recombinant Human UBE2E2 protein, His-tagged
Cat.No. : | UBE2E2-310H |
Product Overview : | Recombinant Human UBE2E2 protein(O00635)(Ser11-Lys120), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | Ser11-Lys120 |
Tag : | C-His |
Form : | Phosphate buffered saline. |
Molecular Mass : | 14 KDa |
Storage : | Store at -20°C to -80°C. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | SPSTSGGSSDGDQRESVQQEPEREQVQPKKKEGKISSKTAAKLSTSAKRIQKELAEITLDPPPNCSAGPKGDNIYEWRSTILGPPGSVYEGGVFFLDITFSPDYPFKPPK |
Gene Name | UBE2E2 ubiquitin-conjugating enzyme E2E 2 [ Homo sapiens ] |
Official Symbol | UBE2E2 |
Synonyms | UBE2E2; ubiquitin-conjugating enzyme E2E 2; ubiquitin conjugating enzyme E2E 2 (homologous to yeast UBC4/5) , ubiquitin conjugating enzyme E2E 2 (UBC4/5 homolog, yeast); ubiquitin-conjugating enzyme E2 E2; FLJ25157; UbcH8; ubiquitin-protein ligase E2; ubiquitin carrier protein E2; ubiquitin-conjugating enzyme E2E 2 (UBC4/5 homolog, yeast); ubiquitin-conjugating enzyme E2E 2 (homologous to yeast UBC4/5); UBCH8; |
Gene ID | 7325 |
mRNA Refseq | NM_152653 |
Protein Refseq | NP_689866 |
MIM | 602163 |
UniProt ID | Q96LR5 |
◆ Recombinant Proteins | ||
UBE2E2-9826M | Recombinant Mouse UBE2E2 Protein, His (Fc)-Avi-tagged | +Inquiry |
UBE2E2-937Z | Recombinant Zebrafish UBE2E2 | +Inquiry |
UBE2E2-311H | Recombinant Human UBE2E2 Protein, His-tagged | +Inquiry |
UBE2E2-310H | Recombinant Human UBE2E2 protein, His-tagged | +Inquiry |
UBE2E2-0025H | Recombinant Human UBE2E2 Protein (S2-T201), Tag Free | +Inquiry |
◆ Cell & Tissue Lysates | ||
UBE2E2-582HCL | Recombinant Human UBE2E2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All UBE2E2 Products
Required fields are marked with *
My Review for All UBE2E2 Products
Required fields are marked with *
0
Inquiry Basket