Recombinant Human UBE2E2 protein, His-tagged

• Cat.No.: UBE2E2-310H
• Product Overview: Recombinant Human UBE2E2 protein(O00635)(Ser11-Lys120), fused with C-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: Ser11-Lys120
• Tag: C-His
• Form: Phosphate buffered saline.
• Molecular Mass: 14 KDa
• Storage: Store at -20°C to -80°C.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
• AA Sequence: SPSTSGGSSDGDQRESVQQEPEREQVQPKKKEGKISSKTAAKLSTSAKRIQKELAEITLDPPPNCSAGPKGDNIYEWRSTILGPPGSVYEGGVFFLDITFSPDYPFKPPK

Gene Information

• Gene Name: UBE2E2 ubiquitin-conjugating enzyme E2E 2 [ Homo sapiens ]
• Official Symbol: UBE2E2
• Synonyms: UBE2E2; ubiquitin-conjugating enzyme E2E 2; ubiquitin conjugating enzyme E2E 2 (homologous to yeast UBC4/5) , ubiquitin conjugating enzyme E2E 2 (UBC4/5 homolog, yeast); ubiquitin-conjugating enzyme E2 E2; FLJ25157; UbcH8; ubiquitin-protein ligase E2; ubiquitin carrier protein E2; ubiquitin-conjugating enzyme E2E 2 (UBC4/5 homolog, yeast); ubiquitin-conjugating enzyme E2E 2 (homologous to yeast UBC4/5); UBCH8
• Gene ID: 7325
• mRNA Refseq: NM_152653
• Protein Refseq: NP_689866
• MIM: 602163
• UniProt ID: Q96LR5