Recombinant Human UBE2F protein, GST-tagged
| Cat.No. : | UBE2F-3533H |
| Product Overview : | Recombinant Human UBE2F protein(1-185 aa), fused with N-terminal GST tag, was expressed in E. coli. |
| Availability | November 21, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 1-185 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| AA Sequence : | MLTLASKLKRDDGLKGSRTAATASDSTRRVSVRDKLLVKEVAELEANLPCTCKVHFPDPNKLHCFQLTVTPDEGYYQGGKFQFETEVPDAYNMVPPKVKCLTKIWHPNITETGEICLSLLREHSIDGTGWAPTRTLKDVVWGLNSLFTDLLNFDDPLNIEAAEHHLRDKEDFRNKVDDYIKRYAR |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Official Symbol | UBE2F |
| Synonyms | UBE2F; ubiquitin-conjugating enzyme E2F (UBC6 homolog, C. elegans); NCE2; NEDD8 conjugating enzyme; |
| Gene ID | 23665 |
| UniProt ID | Q969M7 |
| ◆ Recombinant Proteins | ||
| UBE2F-17715M | Recombinant Mouse UBE2F Protein | +Inquiry |
| UBE2F-4872R | Recombinant Rhesus Macaque UBE2F Protein, His (Fc)-Avi-tagged | +Inquiry |
| UBE2F-2484H | Recombinant Human Ubiquitin-Conjugating Enzyme E2F (putative), His-tagged | +Inquiry |
| UBE2F-255H | Recombinant Human UBE2F Protein, MYC/DDK-tagged | +Inquiry |
| UBE2F-3533H | Recombinant Human UBE2F protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| UBE2F-719HCL | Recombinant Human UBE2F lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All UBE2F Products
Required fields are marked with *
My Review for All UBE2F Products
Required fields are marked with *
