Recombinant Human UBE2F protein, GST-tagged
Cat.No. : | UBE2F-3533H |
Product Overview : | Recombinant Human UBE2F protein(1-185 aa), fused with N-terminal GST tag, was expressed in E. coli. |
Availability | May 21, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-185 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
AA Sequence : | MLTLASKLKRDDGLKGSRTAATASDSTRRVSVRDKLLVKEVAELEANLPCTCKVHFPDPNKLHCFQLTVTPDEGYYQGGKFQFETEVPDAYNMVPPKVKCLTKIWHPNITETGEICLSLLREHSIDGTGWAPTRTLKDVVWGLNSLFTDLLNFDDPLNIEAAEHHLRDKEDFRNKVDDYIKRYAR |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Official Symbol | UBE2F |
Synonyms | UBE2F; ubiquitin-conjugating enzyme E2F (UBC6 homolog, C. elegans); NCE2; NEDD8 conjugating enzyme; |
Gene ID | 23665 |
UniProt ID | Q969M7 |
◆ Recombinant Proteins | ||
UBE2F-0008H | Recombinant Human UBE2F Protein (L2-R185), His/Strep tagged | +Inquiry |
UBE2F-803H | Active Recombinant Human UBE2F Protein, His-tagged | +Inquiry |
UBE2F-17715M | Recombinant Mouse UBE2F Protein | +Inquiry |
UBE2F-207H | Recombinant Human UBE2F, His-tagged | +Inquiry |
UBE2F-1650C | Recombinant Chicken UBE2F | +Inquiry |
◆ Cell & Tissue Lysates | ||
UBE2F-719HCL | Recombinant Human UBE2F lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All UBE2F Products
Required fields are marked with *
My Review for All UBE2F Products
Required fields are marked with *
0
Inquiry Basket