Recombinant Human UBE2Q2 Protein, GST-tagged

• Cat.No.: UBE2Q2-4741H
• Product Overview: Human LOC92912 partial ORF ( NP_775740, 1 a.a. - 110 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: UBE2Q2 (Ubiquitin Conjugating Enzyme E2 Q2) is a Protein Coding gene. Among its related pathways are Innate Immune System and Class I MHC mediated antigen processing and presentation. GO annotations related to this gene include ligase activity and acid-amino acid ligase activity. An important paralog of this gene is UBE2Q1.
• Molecular Mass: 37.84 kDa
• AA Sequence: MSVSGLKAELKFLASIFDKNHERFRIVSWKLDELHCQFLVPQQGSPHSLPPPLTLHCNITESYPSSSPIWFVDSEDPNLTSVLERLEDTKNNNLLRQQLKWLICELCSLY
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: UBE2Q2 ubiquitin-conjugating enzyme E2Q family member 2 [ Homo sapiens ]
• Official Symbol: UBE2Q2
• Synonyms: UBE2Q2; ubiquitin-conjugating enzyme E2Q family member 2; ubiquitin conjugating enzyme E2Q (putative) 2; ubiquitin-conjugating enzyme E2 Q2; DKFZp762C143; ubiquitin-protein ligase Q2; ubiquitin carrier protein Q2
• Gene ID: 92912
• mRNA Refseq: NM_001145335
• Protein Refseq: NP_001138807
• MIM: 612501
• UniProt ID: Q8WVN8