Recombinant Human UBE2Q2 Protein, GST-tagged
| Cat.No. : | UBE2Q2-4741H |
| Product Overview : | Human LOC92912 partial ORF ( NP_775740, 1 a.a. - 110 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | UBE2Q2 (Ubiquitin Conjugating Enzyme E2 Q2) is a Protein Coding gene. Among its related pathways are Innate Immune System and Class I MHC mediated antigen processing and presentation. GO annotations related to this gene include ligase activity and acid-amino acid ligase activity. An important paralog of this gene is UBE2Q1. |
| Molecular Mass : | 37.84 kDa |
| AA Sequence : | MSVSGLKAELKFLASIFDKNHERFRIVSWKLDELHCQFLVPQQGSPHSLPPPLTLHCNITESYPSSSPIWFVDSEDPNLTSVLERLEDTKNNNLLRQQLKWLICELCSLY |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | UBE2Q2 ubiquitin-conjugating enzyme E2Q family member 2 [ Homo sapiens ] |
| Official Symbol | UBE2Q2 |
| Synonyms | UBE2Q2; ubiquitin-conjugating enzyme E2Q family member 2; ubiquitin conjugating enzyme E2Q (putative) 2; ubiquitin-conjugating enzyme E2 Q2; DKFZp762C143; ubiquitin-protein ligase Q2; ubiquitin carrier protein Q2; |
| Gene ID | 92912 |
| mRNA Refseq | NM_001145335 |
| Protein Refseq | NP_001138807 |
| MIM | 612501 |
| UniProt ID | Q8WVN8 |
| ◆ Recombinant Proteins | ||
| UBE2Q2-3543H | Recombinant Human UBE2Q2, GST-tagged | +Inquiry |
| UBE2Q2-4697H | Recombinant Human UBE2Q2 protein, His-SUMO-tagged | +Inquiry |
| Ube2q2-407M | Recombinant Mouse Ube2q2 Protein, MYC/DDK-tagged | +Inquiry |
| UBE2Q2-2529H | Recombinant Human UBE2Q2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| UBE2Q2-17729M | Recombinant Mouse UBE2Q2 Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| UBE2Q2-564HCL | Recombinant Human UBE2Q2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All UBE2Q2 Products
Required fields are marked with *
My Review for All UBE2Q2 Products
Required fields are marked with *
