Recombinant Human UBE2Q2 Protein, GST-tagged

Cat.No. : UBE2Q2-4741H
Product Overview : Human LOC92912 partial ORF ( NP_775740, 1 a.a. - 110 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : UBE2Q2 (Ubiquitin Conjugating Enzyme E2 Q2) is a Protein Coding gene. Among its related pathways are Innate Immune System and Class I MHC mediated antigen processing and presentation. GO annotations related to this gene include ligase activity and acid-amino acid ligase activity. An important paralog of this gene is UBE2Q1.
Molecular Mass : 37.84 kDa
AA Sequence : MSVSGLKAELKFLASIFDKNHERFRIVSWKLDELHCQFLVPQQGSPHSLPPPLTLHCNITESYPSSSPIWFVDSEDPNLTSVLERLEDTKNNNLLRQQLKWLICELCSLY
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name UBE2Q2 ubiquitin-conjugating enzyme E2Q family member 2 [ Homo sapiens ]
Official Symbol UBE2Q2
Synonyms UBE2Q2; ubiquitin-conjugating enzyme E2Q family member 2; ubiquitin conjugating enzyme E2Q (putative) 2; ubiquitin-conjugating enzyme E2 Q2; DKFZp762C143; ubiquitin-protein ligase Q2; ubiquitin carrier protein Q2;
Gene ID 92912
mRNA Refseq NM_001145335
Protein Refseq NP_001138807
MIM 612501
UniProt ID Q8WVN8

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All UBE2Q2 Products

Required fields are marked with *

My Review for All UBE2Q2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon