Recombinant Human UBE2S, His-tagged

Cat.No. : UBE2S-26459TH
Product Overview : Recombinant fragment, corresponding to amino acids 24-222 of Human E2 EPF with N terminal His tag; Predicted MWt 22 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 24-222 a.a.
Description : This gene encodes a member of the ubiquitin-conjugating enzyme family. The encoded protein is able to form a thiol ester linkage with ubiquitin in a ubiquitin activating enzyme-dependent manner, a characteristic property of ubiquitin carrier proteins.
Conjugation : HIS
Form : Lyophilised:Reconstitute with 86 μl aqua dest.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : TADPPDGIKVFPNEEDLTDLQVTIEGPEGTPYAGGLFRMK LLLGKDFPASPPKGYFLTKIFHPNVGANGEICVNVLKR DWTAELGIRHVLLTIKCLLIHPNPESALNEEAGRLLLE NYEEYAARARLLTEIHGGAGGPSGRAEAGRALASGTEA SSTDPGAPGGPGGAEGPMAKKHAGERDKKLAAKKKTDKKRALRRL
Sequence Similarities : Belongs to the ubiquitin-conjugating enzyme family.
Gene Name UBE2S ubiquitin-conjugating enzyme E2S [ Homo sapiens ]
Official Symbol UBE2S
Synonyms UBE2S; ubiquitin-conjugating enzyme E2S; ubiquitin-conjugating enzyme E2 S; E2 EPF; ubiquitin carrier protein; ubiquitin conjugating enzyme E2 24 kD; ubiquitin protein ligase;
Gene ID 27338
mRNA Refseq NM_014501
Protein Refseq NP_055316
MIM 610309
Uniprot ID Q16763
Chromosome Location 19q13.43
Pathway Adaptive Immune System, organism-specific biosystem; Antigen processing: Ubiquitination & Proteasome degradation, organism-specific biosystem; Class I MHC mediated antigen processing & presentation, organism-specific biosystem;
Function ATP binding; acid-amino acid ligase activity; ligase activity; nucleotide binding; ubiquitin-protein ligase activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All UBE2S Products

Required fields are marked with *

My Review for All UBE2S Products

Required fields are marked with *

0
cart-icon
0
compare icon