Recombinant Human UBE2T protein, GST-tagged

• Cat.No.: UBE2T-30152H
• Product Overview: Recombinant Human UBE2T (1-197 aa) protein, fused to GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: Met1-Val197
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• AA Sequence: MQRASRLKRELHMLATEPPPGITCWQDKDQMDDLRAQILGGANTPYEKGVFKLEVIIPERYPFEPPQIRFLTPIYHPNIDSAGRICLDVLKLPPKGAWRPSLNIATVLTSIQLLMSEPNPDDPLMADISSEFKYNKPAFLKNARQWTEKHARQKQKADEEEMLDNLPEAGDSRVHNSTQKRKASQLVGIEKKFHPDV
• Purity: 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Stability: Store for up to 12 months at -20°C to -80°C as lyophilized powder.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.

Gene Information

• Gene Name: UBE2T ubiquitin-conjugating enzyme E2T (putative) [ Homo sapiens ]
• Official Symbol: UBE2T
• Synonyms: UBE2T; ubiquitin-conjugating enzyme E2T (putative); ubiquitin-conjugating enzyme E2 T; HSPC150; ubiquitin-protein ligase T; ubiquitin carrier protein T; ubiquitin conjugating enzyme; cell proliferation-inducing gene 50 protein; HSPC150 protein similar to ubiquitin-conjugating enzyme; PIG50
• Gene ID: 29089
• mRNA Refseq: NM_014176
• Protein Refseq: NP_054895
• MIM: 610538
• UniProt ID: Q9NPD8