Recombinant Human UBE2T protein, GST-tagged
Cat.No. : | UBE2T-30152H |
Product Overview : | Recombinant Human UBE2T (1-197 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | Met1-Val197 |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | MQRASRLKRELHMLATEPPPGITCWQDKDQMDDLRAQILGGANTPYEKGVFKLEVIIPERYPFEPPQIRFLTPIYHPNIDSAGRICLDVLKLPPKGAWRPSLNIATVLTSIQLLMSEPNPDDPLMADISSEFKYNKPAFLKNARQWTEKHARQKQKADEEEMLDNLPEAGDSRVHNSTQKRKASQLVGIEKKFHPDV |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Gene Name | UBE2T ubiquitin-conjugating enzyme E2T (putative) [ Homo sapiens ] |
Official Symbol | UBE2T |
Synonyms | UBE2T; ubiquitin-conjugating enzyme E2T (putative); ubiquitin-conjugating enzyme E2 T; HSPC150; ubiquitin-protein ligase T; ubiquitin carrier protein T; ubiquitin conjugating enzyme; cell proliferation-inducing gene 50 protein; HSPC150 protein similar to ubiquitin-conjugating enzyme; PIG50; |
Gene ID | 29089 |
mRNA Refseq | NM_014176 |
Protein Refseq | NP_054895 |
MIM | 610538 |
UniProt ID | Q9NPD8 |
◆ Recombinant Proteins | ||
UBE2T-0013H | Recombinant Human UBE2T Protein (Q2-V197), Tag Free | +Inquiry |
UBE2T-141H | Recombinant Human UBE2T | +Inquiry |
UBE2T-3546H | Recombinant Human UBE2T, GST-tagged | +Inquiry |
UBE2T-561H | Recombinant Human UBE2T Protein (Met1-Val197), His-tagged | +Inquiry |
UBE2T-142H | Recombinant Human UBE2T, His-SUMO-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
UBE2T-561HCL | Recombinant Human UBE2T 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All UBE2T Products
Required fields are marked with *
My Review for All UBE2T Products
Required fields are marked with *
0
Inquiry Basket