Recombinant Human UBE2Z protein, HIS-tagged
Cat.No. : | UBE2Z-006H |
Product Overview : | Recombinant Human UBE2Z fused with His tag at N-terminal was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Description : | This gene encodes an enzyme which ubiquitinates proteins which participate in signaling pathways and apoptosis. |
Form : | Supplied as a 0.2 µM filtered solution of 50mM HEPES, 50mM NaCl, pH 8.0 |
Molecular Mass : | 30.2kD |
AA Sequence : | MGSSHHHHHHSSGLVPRGSHMSIYKEPPPGMFVVPDTVDMTKIHALITGPFDTPYEGGFFLFVFRCPPDYPIHPPRVKLMTTGNNTVRFNPNFYRNGKVCLSILGTWTGPAWSPAQSISSVLISIQSLMTENPYHNEPGFEQERHPGDSKNYNECIRHETIRVAVCDMMEGKCPCPEPLRGVMEKSFLEYYDFYEVACKDRLHLQGQTMQDPFGEKRGHFDYQSLLMRLGLIRQKVLERLHNENAEMDSDSSSSG |
Endotoxin : | Endotoxin level is <0.1 ng/µg of protein (<1EU/µg). |
Purity : | >95% as determined by SDS-PAGE and Coomassie blue staining |
Gene Name | UBE2Z ubiquitin conjugating enzyme E2 Z [ Homo sapiens (human) ] |
Official Symbol | UBE2Z |
Synonyms | USE1; HOYS7; UBE2Z |
Gene ID | 65264 |
mRNA Refseq | NM_023079 |
Protein Refseq | NP_075567 |
MIM | 611362 |
UniProt ID | Q9H832 |
◆ Recombinant Proteins | ||
UBE2Z-17737M | Recombinant Mouse UBE2Z Protein | +Inquiry |
UBE2Z-006H | Recombinant Human UBE2Z protein, HIS-tagged | +Inquiry |
UBE2Z-479Z | Recombinant Zebrafish UBE2Z | +Inquiry |
UBE2Z-6061R | Recombinant Rat UBE2Z Protein, His (Fc)-Avi-tagged | +Inquiry |
UBE2Z-9841M | Recombinant Mouse UBE2Z Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
UBE2Z-1873HCL | Recombinant Human UBE2Z cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All UBE2Z Products
Required fields are marked with *
My Review for All UBE2Z Products
Required fields are marked with *
0
Inquiry Basket