Recombinant Human UBE2Z protein, HIS-tagged

Cat.No. : UBE2Z-006H
Product Overview : Recombinant Human UBE2Z fused with His tag at N-terminal was expressed in E.coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Description : This gene encodes an enzyme which ubiquitinates proteins which participate in signaling pathways and apoptosis.
Form : Supplied as a 0.2 µM filtered solution of 50mM HEPES, 50mM NaCl, pH 8.0
Molecular Mass : 30.2kD
AA Sequence : MGSSHHHHHHSSGLVPRGSHMSIYKEPPPGMFVVPDTVDMTKIHALITGPFDTPYEGGFFLFVFRCPPDYPIHPPRVKLMTTGNNTVRFNPNFYRNGKVCLSILGTWTGPAWSPAQSISSVLISIQSLMTENPYHNEPGFEQERHPGDSKNYNECIRHETIRVAVCDMMEGKCPCPEPLRGVMEKSFLEYYDFYEVACKDRLHLQGQTMQDPFGEKRGHFDYQSLLMRLGLIRQKVLERLHNENAEMDSDSSSSG
Endotoxin : Endotoxin level is <0.1 ng/µg of protein (<1EU/µg).
Purity : >95% as determined by SDS-PAGE and Coomassie blue staining
Gene Name UBE2Z ubiquitin conjugating enzyme E2 Z [ Homo sapiens (human) ]
Official Symbol UBE2Z
Synonyms USE1; HOYS7; UBE2Z
Gene ID 65264
mRNA Refseq NM_023079
Protein Refseq NP_075567
MIM 611362
UniProt ID Q9H832

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All UBE2Z Products

Required fields are marked with *

My Review for All UBE2Z Products

Required fields are marked with *

0
cart-icon