Recombinant Human UBE2Z protein, HIS-tagged

• Cat.No.: UBE2Z-006H
• Product Overview: Recombinant Human UBE2Z fused with His tag at N-terminal was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Description: This gene encodes an enzyme which ubiquitinates proteins which participate in signaling pathways and apoptosis.
• Form: Supplied as a 0.2 µM filtered solution of 50mM HEPES, 50mM NaCl, pH 8.0
• Molecular Mass: 30.2kD
• AA Sequence: MGSSHHHHHHSSGLVPRGSHMSIYKEPPPGMFVVPDTVDMTKIHALITGPFDTPYEGGFFLFVFRCPPDYPIHPPRVKLMTTGNNTVRFNPNFYRNGKVCLSILGTWTGPAWSPAQSISSVLISIQSLMTENPYHNEPGFEQERHPGDSKNYNECIRHETIRVAVCDMMEGKCPCPEPLRGVMEKSFLEYYDFYEVACKDRLHLQGQTMQDPFGEKRGHFDYQSLLMRLGLIRQKVLERLHNENAEMDSDSSSSG
• Endotoxin: Endotoxin level is <0.1 ng/µg of protein (<1EU/µg).
• Purity: >95% as determined by SDS-PAGE and Coomassie blue staining

Gene Information

• Gene Name: UBE2Z ubiquitin conjugating enzyme E2 Z [ Homo sapiens (human) ]
• Official Symbol: UBE2Z
• Synonyms: USE1; HOYS7; UBE2Z
• Gene ID: 65264
• mRNA Refseq: NM_023079
• Protein Refseq: NP_075567
• MIM: 611362
• UniProt ID: Q9H832