Recombinant Human UBE3A protein, GST-tagged
| Cat.No. : | UBE3A-3550H |
| Product Overview : | Recombinant Human UBE3A protein(30-235 aa), fused with N-terminal GST tag, was expressed in E.coli. |
| Availability | May 22, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 30-235 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.0). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| AASequence : | IERYYHQLTEGCGNEACTNEFCASCPTFLRMDNNAAAIKALELYKINAKLCDPHPSKKGASSAYLENSKGAPNNSCSEIKMNKKGARIDFKDVTYLTEEKVYEILELCREREDYSPLIRVIGRVFSSAEALVQSFRKVKQHTKEELKSLQAKDEDKDEDEKEKAACSAAAMEEDSEASSSRIGDSSQGDNNLQKLGPDDVSVDIDA |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
| Gene Name | UBE3A ubiquitin protein ligase E3A [ Homo sapiens ] |
| Official Symbol | UBE3A |
| Synonyms | UBE3A; ubiquitin protein ligase E3A; EPVE6AP, HPVE6A, human papilloma virus E6 associated protein; ubiquitin-protein ligase E3A; ANCR; Angelman syndrome; AS; E6 AP; FLJ26981; CTCL tumor antigen se37-2; E6AP ubiquitin-protein ligase; renal carcinoma antigen NY-REN-54; human papillomavirus E6-associated protein; oncogenic protein-associated protein E6-AP; human papilloma virus E6-associated protein; E6-AP; HPVE6A; EPVE6AP; |
| Gene ID | 7337 |
| mRNA Refseq | NM_000462 |
| Protein Refseq | NP_000453 |
| MIM | 601623 |
| UniProt ID | Q05086 |
| ◆ Recombinant Proteins | ||
| UBE3A-2369H | Recombinant Human UBE3A Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| UBE3A-5071R | Recombinant Rhesus monkey UBE3A Protein, His-tagged | +Inquiry |
| UBE3A-03H | Purified Recombinant Human UBE3A Protein, C-Myc/DDK-Tagged | +Inquiry |
| UBE3A-13HFL | Recombinant Human UBE3A Peorein (Full length), N His-FLAG tagged | +Inquiry |
| UBE3A-505HFL | Recombinant Full Length Human UBE3A Protein, C-Flag-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| UBE3A-557HCL | Recombinant Human UBE3A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All UBE3A Products
Required fields are marked with *
My Review for All UBE3A Products
Required fields are marked with *
