Recombinant Human UBE3A protein, GST-tagged

Cat.No. : UBE3A-3550H
Product Overview : Recombinant Human UBE3A protein(9-215 aa), fused with N-terminal GST tag, was expressed in E. coli.
Availability August 02, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 9-215 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
AA Sequence : GEPQSDDIEASRMKRAAAKHLIERYYHQLTEGCGNEACTNEFCASCPTFLRMDNNAAAIKALELYKINAKLCDPHPSKKGASSAYLENSKGAPNNSCSEIKMNKKGARIDFKDVTYLTEEKVYEILELCREREDYSPLIRVIGRVFSSAEALVQSFRKVKQHTKEELKSLQAKDEDKDEDEKEKAACSAAAMEEDSEASSSRIGDSS
Purity : 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Official Symbol UBE3A
Synonyms UBE3A; ubiquitin protein ligase E3A; EPVE6AP, HPVE6A, human papilloma virus E6 associated protein; ubiquitin-protein ligase E3A; ANCR; Angelman syndrome; AS; E6 AP; FLJ26981; CTCL tumor antigen se37-2; E6AP ubiquitin-protein ligase; renal carcinoma antigen NY-REN-54; human papillomavirus E6-associated protein; oncogenic protein-associated protein E6-AP; human papilloma virus E6-associated protein; E6-AP; HPVE6A; EPVE6AP;
Gene ID 7337
mRNA Refseq NM_000462
Protein Refseq NP_000453
MIM 601623
UniProt ID Q05086

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All UBE3A Products

Required fields are marked with *

My Review for All UBE3A Products

Required fields are marked with *

0
cart-icon