Recombinant Human UBE3A protein, GST-tagged
Cat.No. : | UBE3A-3550H |
Product Overview : | Recombinant Human UBE3A protein(9-215 aa), fused with N-terminal GST tag, was expressed in E. coli. |
Availability | August 02, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 9-215 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
AA Sequence : | GEPQSDDIEASRMKRAAAKHLIERYYHQLTEGCGNEACTNEFCASCPTFLRMDNNAAAIKALELYKINAKLCDPHPSKKGASSAYLENSKGAPNNSCSEIKMNKKGARIDFKDVTYLTEEKVYEILELCREREDYSPLIRVIGRVFSSAEALVQSFRKVKQHTKEELKSLQAKDEDKDEDEKEKAACSAAAMEEDSEASSSRIGDSS |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Official Symbol | UBE3A |
Synonyms | UBE3A; ubiquitin protein ligase E3A; EPVE6AP, HPVE6A, human papilloma virus E6 associated protein; ubiquitin-protein ligase E3A; ANCR; Angelman syndrome; AS; E6 AP; FLJ26981; CTCL tumor antigen se37-2; E6AP ubiquitin-protein ligase; renal carcinoma antigen NY-REN-54; human papillomavirus E6-associated protein; oncogenic protein-associated protein E6-AP; human papilloma virus E6-associated protein; E6-AP; HPVE6A; EPVE6AP; |
Gene ID | 7337 |
mRNA Refseq | NM_000462 |
Protein Refseq | NP_000453 |
MIM | 601623 |
UniProt ID | Q05086 |
◆ Recombinant Proteins | ||
UBE3A-1463H | Recombinant Human UBE3A protein, His-tagged | +Inquiry |
UBE3A-1699HFL | Recombinant Full Length Human UBE3A Protein, MYC/DDK-tagged | +Inquiry |
UBE3A-13HFL | Recombinant Human UBE3A Peorein (Full length), N His-FLAG tagged | +Inquiry |
UBE3A-2369H | Recombinant Human UBE3A Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
UBE3A-1986M | Recombinant Mouse UBE3A Protein (542-870 aa), His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
UBE3A-557HCL | Recombinant Human UBE3A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All UBE3A Products
Required fields are marked with *
My Review for All UBE3A Products
Required fields are marked with *