Recombinant Human UBE3C Protein (599-698), N-GST tagged
Cat.No. : | UBE3C-06H |
Product Overview : | Human UBE3C partial ORF (NP_055486, 599-698 a.a.) recombinant protein with GST-tag at N-terminal ws expressed in Wheat Germ (in vitro). |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Protein Length : | 599-698 |
Description : | Enables ubiquitin protein ligase activity. Involved in protein polyubiquitination. Predicted to be located in nucleus. Predicted to be part of proteasome complex. |
Molecular Mass : | 36.74 kDa |
AA Sequence : | IQLFKVITNLVKMLKSRDTRRNFCPPNHWLSEQEDIKADKVTQLYVPASRHVWRFRRMGRIGPLQSTLDVGLESPPLSVSEERQLAVLTELPFVVPFEER |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer. |
Gene Name | UBE3C ubiquitin protein ligase E3C [ Homo sapiens (human) ] |
Official Symbol | UBE3C |
Synonyms | UBE3C; ubiquitin protein ligase E3C; RAUL; HECTH2; NDSMBA; NEDSMBA; ubiquitin-protein ligase E3C; HECT-type ubiquitin transferase E3C; RTA-associated ubiquitin ligase; homologous to E6AP carboxyl terminus homologous protein 2; ubiquitin-protein isopeptide ligase (E3); EC 2.3.2.26 |
Gene ID | 9690 |
mRNA Refseq | NM_014671 |
Protein Refseq | NP_055486 |
MIM | 614454 |
UniProt ID | Q15386 |
◆ Recombinant Proteins | ||
UBE3C-17740M | Recombinant Mouse UBE3C Protein | +Inquiry |
UBE3C-2458H | Recombinant Human UBE3C Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
UBE3C-2300H | Recombinant Human UBE3C Protein, His (Fc)-Avi-tagged | +Inquiry |
UBE3C-1868HFL | Recombinant Full Length Human UBE3C Protein, C-Flag-tagged | +Inquiry |
UBE3C-06H | Recombinant Human UBE3C Protein (599-698), N-GST tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
UBE3C-1874HCL | Recombinant Human UBE3C cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All UBE3C Products
Required fields are marked with *
My Review for All UBE3C Products
Required fields are marked with *