Recombinant Human UBE3C Protein (599-698), N-GST tagged

Cat.No. : UBE3C-06H
Product Overview : Human UBE3C partial ORF (NP_055486, 599-698 a.a.) recombinant protein with GST-tag at N-terminal ws expressed in Wheat Germ (in vitro).
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Protein Length : 599-698
Description : Enables ubiquitin protein ligase activity. Involved in protein polyubiquitination. Predicted to be located in nucleus. Predicted to be part of proteasome complex.
Molecular Mass : 36.74 kDa
AA Sequence : IQLFKVITNLVKMLKSRDTRRNFCPPNHWLSEQEDIKADKVTQLYVPASRHVWRFRRMGRIGPLQSTLDVGLESPPLSVSEERQLAVLTELPFVVPFEER
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Gene Name UBE3C ubiquitin protein ligase E3C [ Homo sapiens (human) ]
Official Symbol UBE3C
Synonyms UBE3C; ubiquitin protein ligase E3C; RAUL; HECTH2; NDSMBA; NEDSMBA; ubiquitin-protein ligase E3C; HECT-type ubiquitin transferase E3C; RTA-associated ubiquitin ligase; homologous to E6AP carboxyl terminus homologous protein 2; ubiquitin-protein isopeptide ligase (E3); EC 2.3.2.26
Gene ID 9690
mRNA Refseq NM_014671
Protein Refseq NP_055486
MIM 614454
UniProt ID Q15386

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All UBE3C Products

Required fields are marked with *

My Review for All UBE3C Products

Required fields are marked with *

0
cart-icon
0
compare icon