Recombinant Human UBE4B, GST-tagged

Cat.No. : UBE4B-3553H
Product Overview : Recombinant Human UBE4B( 1075 a.a. - 1173 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes an additional conjugation factor, E4, which is involved in multiubiquitin chain assembly. This gene is also the strongest candidate in the neuroblastoma tumor suppressor genes. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.
Molecular Mass : 36.63 kDa
AA Sequence : FKLLAEKVEEIVAKNARAEIDYSDAPDEFRDPLMDTLMTDPVRLPSGTIMDRSIILRHLLNSPTDPFNRQTLTES MLEPVPELKEQIQAWMREKQNSDH
Applications : ELISA; WB-Re; AP; Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name UBE4B ubiquitination factor E4B [ Homo sapiens (human) ]
Official Symbol UBE4B
Synonyms UBE4B; E4; UFD2; HDNB1; UBOX3; UFD2A; ubiquitination factor E4B; ubiquitin conjugation factor E4 B; homologous to yeast UFD2; UFD2A-III/UBE4B-III splice isoform; ubiquitin fusion degradation protein 2; ubiquitin-fusion degradation protein 2; homozygously deleted in neuroblastoma 1; homozygously deleted in neuroblastoma-1; ubiquitination factor E4B (UFD2 homolog, yeast); ubiquitination factor E4B (homologous to yeast UFD2)
Gene ID 10277
mRNA Refseq NM_006048
Protein Refseq NP_006039
MIM 613565
UniProt ID O95155
Chromosome Location 1p36.3
Pathway Protein processing in endoplasmic reticulum; Ubiquitin mediated proteolysis
Function enzyme binding; ubiquitin-ubiquitin ligase activity

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All UBE4B Products

Required fields are marked with *

My Review for All UBE4B Products

Required fields are marked with *

0

Inquiry Basket

cartIcon