Recombinant Human UBL3, His-tagged
Cat.No. : | UBL3-31553TH |
Product Overview : | Recombinant full length Human UBL3 with an N terminal His tag; 134 amino acids with tag, MWt 15 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 114 amino acids |
Description : | Ubiquitin-like protein 3 is a protein that in humans is encoded by the UBL3 gene. |
Conjugation : | HIS |
Molecular Weight : | 15.000kDa inclusive of tags |
Tissue specificity : | Ubiquitous. |
Form : | Liquid |
Purity : | >90% by SDS-PAGE |
Storage buffer : | Preservative: NoneConstituents: 20% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 2mM DTT, pH 8.0 |
Storage : | Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMSSNVPADMINLRLILVSGKTKEFLFSPNDSASDIAKHVYDNWPMDWEEEQVSSPNILRLIYQGRFLHGNVTLGALKLPFGKTTVMHLVARETLPEPNSQGQRNREKTGESNCC |
Sequence Similarities : | Contains 1 ubiquitin-like domain. |
Gene Name | UBL3 ubiquitin-like 3 [ Homo sapiens ] |
Official Symbol | UBL3 |
Synonyms | UBL3; ubiquitin-like 3; PNSC1; ubiquitin-like protein 3; DKFZP434K151; FLJ32018; HCG 1; |
Gene ID | 5412 |
mRNA Refseq | NM_007106 |
Protein Refseq | NP_009037 |
MIM | 604711 |
Uniprot ID | O95164 |
Chromosome Location | 13q12-q13 |
◆ Recombinant Proteins | ||
UBL3-5074R | Recombinant Rhesus monkey UBL3 Protein, His-tagged | +Inquiry |
UBL3-3197H | Recombinant Human UBL3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
UBL3-68H | Recombinant Human Ubiquitin-like 3, His-tagged | +Inquiry |
UBL3-6241H | Recombinant Human UBL3 protein, His-tagged | +Inquiry |
UBL3-17745M | Recombinant Mouse UBL3 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
UBL3-555HCL | Recombinant Human UBL3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All UBL3 Products
Required fields are marked with *
My Review for All UBL3 Products
Required fields are marked with *
0
Inquiry Basket