Recombinant Human UBL3, His-tagged

• Cat.No.: UBL3-31553TH
• Product Overview: Recombinant full length Human UBL3 with an N terminal His tag; 134 amino acids with tag, MWt 15 kDa.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 114 amino acids
• Description: Ubiquitin-like protein 3 is a protein that in humans is encoded by the UBL3 gene.
• Conjugation: HIS
• Molecular Weight: 15.000kDa inclusive of tags
• Tissue specificity: Ubiquitous.
• Form: Liquid
• Purity: >90% by SDS-PAGE
• Storage buffer: Preservative: NoneConstituents: 20% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 2mM DTT, pH 8.0
• Storage: Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
• Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMSSNVPADMINLRLILVSGKTKEFLFSPNDSASDIAKHVYDNWPMDWEEEQVSSPNILRLIYQGRFLHGNVTLGALKLPFGKTTVMHLVARETLPEPNSQGQRNREKTGESNCC
• Sequence Similarities: Contains 1 ubiquitin-like domain.

Gene Information

• Gene Name: UBL3 ubiquitin-like 3 [ Homo sapiens ]
• Official Symbol: UBL3
• Synonyms: UBL3; ubiquitin-like 3; PNSC1; ubiquitin-like protein 3; DKFZP434K151; FLJ32018; HCG 1
• Gene ID: 5412
• mRNA Refseq: NM_007106
• Protein Refseq: NP_009037
• MIM: 604711
• Uniprot ID: O95164
• Chromosome Location: 13q12-q13