Recombinant Human UBL4B protein, His-tagged
| Cat.No. : | UBL4B-3340H |
| Product Overview : | Recombinant Human UBL4B protein(1-174 aa), fused to His tag, was expressed in E. coli. |
| Availability | December 18, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-174 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | MFLTVKLLLGQRCSLKVSGQESVATLKRLVSRRLKVPEEQQHLLFRGQLLEDDKHLSDYCIGPNASINVIMQPLEKMALKEAHQPQTQPLWHQLGLVLAKHFEPQDAKAVLQLLRQEHEERLQKISLEHLEQLAQYLLAEEPHVEPAGERELEAKARPQSSCDMEEKEEAAADQ |
| Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | UBL4B ubiquitin-like 4B [ Homo sapiens ] |
| Official Symbol | UBL4B |
| Synonyms | UBL4B; ubiquitin-like 4B; ubiquitin-like protein 4B; FLJ25690; |
| Gene ID | 164153 |
| mRNA Refseq | NM_203412 |
| Protein Refseq | NP_981957 |
| MIM | 611127 |
| UniProt ID | Q8N7F7 |
| ◆ Recombinant Proteins | ||
| UBL4B-3340H | Recombinant Human UBL4B protein, His-tagged | +Inquiry |
| UBL4B-17747M | Recombinant Mouse UBL4B Protein | +Inquiry |
| UBL4B-3553H | Recombinant Human UBL4B protein, GST-tagged | +Inquiry |
| UBL4B-9849M | Recombinant Mouse UBL4B Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| UBL4B-1875HCL | Recombinant Human UBL4B cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All UBL4B Products
Required fields are marked with *
My Review for All UBL4B Products
Required fields are marked with *
