Recombinant Human UBQLN2 protein, His-tagged
Cat.No. : | UBQLN2-4644H |
Product Overview : | Recombinant Human UBQLN2 protein(275-624 aa), fused with N-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 275-624 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole. |
AASequence : | IQEPMLNAAQEQFGGNPFASVGSSSSSGEGTQPSRTENRDPLPNPWAPPPATQSSATTSTTTSTGSGSGNSSSNATGNTVAAANYVASIFSTPGMQSLLQQITENPQLIQNMLSAPYMRSMMQSLSQNPDLAAQMMLNSPLFTANPQLQEQMRPQLPAFLQQMQNPDTLSAMSNPRAMQALMQIQQGLQTLATEAPGLIPSFTPGVGVGVLGTAIGPVGPVTPIGPIGPIVPFTPIGPIGPIGPTGPAAPPGSTGSGGPTGPTVSSAAPSETTSPTSESGPNQQFIQQMVQALAGANAPQLPNPEVRFQQQLEQLNAMGFLNREANLQALIATGGDINAAIERLLGSQPS |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
Gene Name | UBQLN2 ubiquilin 2 [ Homo sapiens ] |
Official Symbol | UBQLN2 |
Synonyms | UBQLN2; ubiquilin 2; ubiquilin-2; Chap1; CHAP1/DSK2; Dsk2; LIC 2; N4BP4; NEDD4 binding protein 4; PLIC 2; PLIC2; RIHFB2157; Nedd4 binding protein 4; ubiquitin-like product Chap1/Dsk2; protein linking IAP with cytoskeleton 2; DSK2; ALS15; CHAP1; HRIHFB2157; FLJ10167; FLJ56541; |
Gene ID | 29978 |
mRNA Refseq | NM_013444 |
Protein Refseq | NP_038472 |
MIM | 300264 |
UniProt ID | Q9UHD9 |
◆ Recombinant Proteins | ||
UBQLN2-3559H | Recombinant Human UBQLN2 protein, GST-tagged | +Inquiry |
UBQLN2-46H | Recombinant Human UBQLN2 protein, His-tagged | +Inquiry |
UBQLN2-9856M | Recombinant Mouse UBQLN2 Protein, His (Fc)-Avi-tagged | +Inquiry |
UBQLN2-96H | Recombinant Human UBQLN2, GST-tagged | +Inquiry |
UBQLN2-613H | Recombinant Human UBQLN2 Protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All UBQLN2 Products
Required fields are marked with *
My Review for All UBQLN2 Products
Required fields are marked with *
0
Inquiry Basket