Recombinant Human UBQLN4 protein, His-tagged
| Cat.No. : | UBQLN4-3839H |
| Product Overview : | Recombinant Human UBQLN4 protein(290-390 aa), fused with N-terminal His tag, was expressed in E.coli. |
| Availability | February 04, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 290-390 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AASequence : | QEPMFSAAREQFGNNPFSSLAGNSDSSSSQPLRTENREPLPNPWSPSPPTSQAPGSGGEGTGGSGTSQVHPTVSNPFGINAASLGSGMFNSPEMQALLQQI |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
| Gene Name | UBQLN4 ubiquilin 4 [ Homo sapiens ] |
| Official Symbol | UBQLN4 |
| Synonyms | UBQLN4; ubiquilin 4; C1orf6, chromosome 1 open reading frame 6; ubiquilin-4; A1U; ataxin 1 ubiquitin like interacting protein; UBIN; connexin43-interacting protein of 75 kDa; ataxin-1 interacting ubiquitin-like protein; ataxin-1 ubiquitin-like interacting protein; ataxin-1 ubiquitin-like-interacting protein A1U; A1Up; CIP75; C1orf6; |
| Gene ID | 56893 |
| mRNA Refseq | NM_020131 |
| Protein Refseq | NP_064516 |
| MIM | 605440 |
| UniProt ID | Q9NRR5 |
| ◆ Recombinant Proteins | ||
| UBQLN4-3024C | Recombinant Chicken UBQLN4 | +Inquiry |
| UBQLN4-12536Z | Recombinant Zebrafish UBQLN4 | +Inquiry |
| UBQLN4-3839H | Recombinant Human UBQLN4 protein, His-tagged | +Inquiry |
| UBQLN4-6555H | Recombinant Human UBQLN4 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| UBQLN4-528H | Recombinant Human UBQLN4 Protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| UBQLN4-545HCL | Recombinant Human UBQLN4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All UBQLN4 Products
Required fields are marked with *
My Review for All UBQLN4 Products
Required fields are marked with *
