Recombinant Human UBQLN4 protein, His-tagged
Cat.No. : | UBQLN4-3839H |
Product Overview : | Recombinant Human UBQLN4 protein(290-390 aa), fused to His tag, was expressed in E. coli. |
Availability | July 06, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 290-390 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | QEPMFSAAREQFGNNPFSSLAGNSDSSSSQPLRTENREPLPNPWSPSPPTSQAPGSGGEGTGGSGTSQVHPTVSNPFGINAASLGSGMFNSPEMQALLQQI |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | UBQLN4 ubiquilin 4 [ Homo sapiens ] |
Official Symbol | UBQLN4 |
Synonyms | UBQLN4; ubiquilin 4; C1orf6, chromosome 1 open reading frame 6; ubiquilin-4; A1U; ataxin 1 ubiquitin like interacting protein; UBIN; connexin43-interacting protein of 75 kDa; ataxin-1 interacting ubiquitin-like protein; ataxin-1 ubiquitin-like interacting protein; ataxin-1 ubiquitin-like-interacting protein A1U; A1Up; CIP75; C1orf6; |
Gene ID | 56893 |
mRNA Refseq | NM_020131 |
Protein Refseq | NP_064516 |
MIM | 605440 |
UniProt ID | Q9NRR5 |
◆ Recombinant Proteins | ||
UBQLN4-3024C | Recombinant Chicken UBQLN4 | +Inquiry |
UBQLN4-9857M | Recombinant Mouse UBQLN4 Protein, His (Fc)-Avi-tagged | +Inquiry |
UBQLN4-17758M | Recombinant Mouse UBQLN4 Protein | +Inquiry |
Ubqln4-6808M | Recombinant Mouse Ubqln4 Protein, Myc/DDK-tagged | +Inquiry |
UBQLN4-3839H | Recombinant Human UBQLN4 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
UBQLN4-545HCL | Recombinant Human UBQLN4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All UBQLN4 Products
Required fields are marked with *
My Review for All UBQLN4 Products
Required fields are marked with *