Recombinant Human UBR4 Protein, GST-Tagged

• Cat.No.: UBR4-01H
• Product Overview: Human RBAF600 partial ORF ( NP_065816, 94 a.a. - 190 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: The protein encoded by this gene is an E3 ubiquitin-protein ligase that interacts with the retinoblastoma-associated protein in the nucleus and with calcium-bound calmodulin in the cytoplasm. The encoded protein appears to be a cytoskeletal component in the cytoplasm and part of the chromatin scaffold in the nucleus. In addition, this protein is a target of the human papillomavirus type 16 E7 oncoprotein.
• Molecular Mass: 36.41kDa
• AA Sequence: RNQLQSVAAACKVLIEFSLLRLENPDEACAVSQKHLILLIKGLCTGCSRLDRTEIITFTAMMKSAKLPQTVKTLSDVEDQKELASPVSPELRQKEVQ
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Purification: Glutathione Sepharose 4 Fast Flow
• Preparation: in vitro wheat germ expression system

Gene Information

• Gene Name: UBR4 ubiquitin protein ligase E3 component n-recognin 4 [ Homo sapiens (human) ]
• Official Symbol: UBR4
• Synonyms: FLJ41863,KIAA0462,KIAA1307,RBAF600,ZUBR1,p600
• Gene ID: 23352
• mRNA Refseq: NM_020765.3
• Protein Refseq: NP_065816.2
• MIM: 609890
• UniProt ID: Q5T4S7