Recombinant Human UBR4 Protein, GST-Tagged

Cat.No. : UBR4-01H
Product Overview : Human RBAF600 partial ORF ( NP_065816, 94 a.a. - 190 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The protein encoded by this gene is an E3 ubiquitin-protein ligase that interacts with the retinoblastoma-associated protein in the nucleus and with calcium-bound calmodulin in the cytoplasm. The encoded protein appears to be a cytoskeletal component in the cytoplasm and part of the chromatin scaffold in the nucleus. In addition, this protein is a target of the human papillomavirus type 16 E7 oncoprotein.
Molecular Mass : 36.41kDa
AA Sequence : RNQLQSVAAACKVLIEFSLLRLENPDEACAVSQKHLILLIKGLCTGCSRLDRTEIITFTAMMKSAKLPQTVKTLSDVEDQKELASPVSPELRQKEVQ
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purification : Glutathione Sepharose 4 Fast Flow
Preparation : in vitro wheat germ expression system
Gene Name UBR4 ubiquitin protein ligase E3 component n-recognin 4 [ Homo sapiens (human) ]
Official Symbol UBR4
Synonyms FLJ41863,KIAA0462,KIAA1307,RBAF600,ZUBR1,p600
Gene ID 23352
mRNA Refseq NM_020765.3
Protein Refseq NP_065816.2
MIM 609890
UniProt ID Q5T4S7

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All UBR4 Products

Required fields are marked with *

My Review for All UBR4 Products

Required fields are marked with *

0
cart-icon