Recombinant Human UBXN8 Protein, GST-tagged

Cat.No. : UBXN8-2311H
Product Overview : Human D8S2298E partial ORF ( NP_005662, 173 a.a. - 268 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : p97 or VCP (valosin-containing protein) is a versatile ATPase complex, and many cofactors are required for the p97 functional diversity. This gene encodes one of the p97 cofactors. This cofactor is a transmembrane protein and localized in the endoplasmic reticulum (ER) membrane. It tethers p97 to the ER membrane via its UBX domain. The association of this cofactor with p97 facilitates efficient ER-associated degradation of misfolded proteins. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.[provided by RefSeq, Aug 2013]
Molecular Mass : 36.3 kDa
AA Sequence : TCKEIPDLPEEPSQTAEEVVTVALRCPSGNVLRRRFLKSYSSQVLFDWMTRIGYHISLYSLSTSFPRRPLAVEGGQSLEDIGITVDTVLILEEKEQ
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name UBXN8 UBX domain protein 8 [ Homo sapiens (human) ]
Official Symbol UBXN8
Synonyms UBXN8; UBX domain protein 8; UBX Domain Protein 8; UBX Domain-Containing Protein 6; Reproduction 8 Protein; Rep-8 Protein; D8S2298E; UBXD6; REP8; UBX Domain-Containing Protein 8; Reproduction/Chromosome 8; UBX Domain Containing 6; UBX domain-containing protein 8; Reproduction/chromosome 8; UBX domain-containing protein 6; rep-8 protein; reproduction 8 protein
Gene ID 7993
mRNA Refseq NM_001282189
Protein Refseq NP_001269118
MIM 602155
UniProt ID O00124

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All UBXN8 Products

Required fields are marked with *

My Review for All UBXN8 Products

Required fields are marked with *

0
cart-icon