Recombinant Human UBXN8 Protein, GST-tagged
Cat.No. : | UBXN8-2311H |
Product Overview : | Human D8S2298E partial ORF ( NP_005662, 173 a.a. - 268 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | p97 or VCP (valosin-containing protein) is a versatile ATPase complex, and many cofactors are required for the p97 functional diversity. This gene encodes one of the p97 cofactors. This cofactor is a transmembrane protein and localized in the endoplasmic reticulum (ER) membrane. It tethers p97 to the ER membrane via its UBX domain. The association of this cofactor with p97 facilitates efficient ER-associated degradation of misfolded proteins. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.[provided by RefSeq, Aug 2013] |
Molecular Mass : | 36.3 kDa |
AA Sequence : | TCKEIPDLPEEPSQTAEEVVTVALRCPSGNVLRRRFLKSYSSQVLFDWMTRIGYHISLYSLSTSFPRRPLAVEGGQSLEDIGITVDTVLILEEKEQ |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | UBXN8 UBX domain protein 8 [ Homo sapiens (human) ] |
Official Symbol | UBXN8 |
Synonyms | UBXN8; UBX domain protein 8; UBX Domain Protein 8; UBX Domain-Containing Protein 6; Reproduction 8 Protein; Rep-8 Protein; D8S2298E; UBXD6; REP8; UBX Domain-Containing Protein 8; Reproduction/Chromosome 8; UBX Domain Containing 6; UBX domain-containing protein 8; Reproduction/chromosome 8; UBX domain-containing protein 6; rep-8 protein; reproduction 8 protein |
Gene ID | 7993 |
mRNA Refseq | NM_001282189 |
Protein Refseq | NP_001269118 |
MIM | 602155 |
UniProt ID | O00124 |
◆ Recombinant Proteins | ||
UBXN8-3014Z | Recombinant Zebrafish UBXN8 | +Inquiry |
RFL35922HF | Recombinant Full Length Human Ubx Domain-Containing Protein 8(Ubxn8) Protein, His-Tagged | +Inquiry |
UBXN8-2311H | Recombinant Human UBXN8 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
UBXN8-536HCL | Recombinant Human UBXN8 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All UBXN8 Products
Required fields are marked with *
My Review for All UBXN8 Products
Required fields are marked with *