Recombinant Human UCHL5 protein, His-SUMO-tagged

Cat.No. : UCHL5-3645H
Product Overview : Recombinant Human UCHL5 protein(Q9Y5K5)(1-326aa), fused to N-terminal His-SUMO tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&SUMO
Protein Length : 1-326aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 53.4 kDa
AA Sequence : MTGNAGEWCLMESDPGVFTELIKGFGCRGAQVEEIWSLEPENFEKLKPVHGLIFLFKWQPGEEPAGSVVQDSRLDTIFFAKQVINNACATQAIVSVLLNCTHQDVHLGETLSEFKEFSQSFDAAMKGLALSNSDVIRQVHNSFARQQMFEFDTKTSAKEEDAFHFVSYVPVNGRLYELDGLREGPIDLGACNQDDWISAVRPVIEKRIQKYSEGEIRFNLMAIVSDRKMIYEQKIAELQRQLAEEPMDTDQGNSMLSAIQSEVAKNQMLIEEEVQKLKRYKIENIRRKHNYLPFIMELLKTLAEHQQLIPLVEKFEKHFEKTLLGK
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.
Gene Name UCHL5 ubiquitin carboxyl-terminal hydrolase L5 [ Homo sapiens ]
Official Symbol UCHL5
Synonyms UCHL5; ubiquitin carboxyl-terminal hydrolase L5; ubiquitin carboxyl-terminal hydrolase isozyme L5; CGI 70; INO80 complex subunit R; INO80R; UCH37; ubiquitin thioesterase L5; ubiquitin C-terminal hydrolase UCH37; ubiquitin carboxyl-terminal esterase L5; CGI-70; UCH-L5;
Gene ID 51377
mRNA Refseq NM_001199261
Protein Refseq NP_001186190
MIM 610667
UniProt ID Q9Y5K5

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All UCHL5 Products

Required fields are marked with *

My Review for All UCHL5 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon