Recombinant Human UCHL5 protein, His-SUMO-tagged
Cat.No. : | UCHL5-3645H |
Product Overview : | Recombinant Human UCHL5 protein(Q9Y5K5)(1-326aa), fused to N-terminal His-SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 1-326aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 53.4 kDa |
AA Sequence : | MTGNAGEWCLMESDPGVFTELIKGFGCRGAQVEEIWSLEPENFEKLKPVHGLIFLFKWQPGEEPAGSVVQDSRLDTIFFAKQVINNACATQAIVSVLLNCTHQDVHLGETLSEFKEFSQSFDAAMKGLALSNSDVIRQVHNSFARQQMFEFDTKTSAKEEDAFHFVSYVPVNGRLYELDGLREGPIDLGACNQDDWISAVRPVIEKRIQKYSEGEIRFNLMAIVSDRKMIYEQKIAELQRQLAEEPMDTDQGNSMLSAIQSEVAKNQMLIEEEVQKLKRYKIENIRRKHNYLPFIMELLKTLAEHQQLIPLVEKFEKHFEKTLLGK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | UCHL5 ubiquitin carboxyl-terminal hydrolase L5 [ Homo sapiens ] |
Official Symbol | UCHL5 |
Synonyms | UCHL5; ubiquitin carboxyl-terminal hydrolase L5; ubiquitin carboxyl-terminal hydrolase isozyme L5; CGI 70; INO80 complex subunit R; INO80R; UCH37; ubiquitin thioesterase L5; ubiquitin C-terminal hydrolase UCH37; ubiquitin carboxyl-terminal esterase L5; CGI-70; UCH-L5; |
Gene ID | 51377 |
mRNA Refseq | NM_001199261 |
Protein Refseq | NP_001186190 |
MIM | 610667 |
UniProt ID | Q9Y5K5 |
◆ Recombinant Proteins | ||
UCHL5-1668C | Recombinant Chicken UCHL5 | +Inquiry |
UCHL5-0898H | Recombinant Human UCHL5 Protein (T2-K329), Tag Free | +Inquiry |
UCHL5-2840H | Recombinant Human UCHL5 protein, His-tagged | +Inquiry |
UCHL5-3645H | Recombinant Human UCHL5 protein, His-SUMO-tagged | +Inquiry |
UCHL5-605B | Recombinant Bovine UCHL5 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
UCHL5-533HCL | Recombinant Human UCHL5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All UCHL5 Products
Required fields are marked with *
My Review for All UCHL5 Products
Required fields are marked with *