Recombinant Human UCP3, His-tagged
Cat.No. : | UCP3-30102TH |
Product Overview : | Recombinant fragment: GTLPNIMRNA IVNCAEVVTY DILKEKLLDY HLLT, corresponding to amino acids 181-214 of Human UCP3 fused to His tag, 10kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 181-214 a.a. |
Description : | Mitochondrial uncoupling proteins (UCP) are members of the larger family of mitochondrial anion carrier proteins (MACP). UCPs separate oxidative phosphorylation from ATP synthesis with energy dissipated as heat, also referred to as the mitochondrial proton leak. UCPs facilitate the transfer of anions from the inner to the outer mitochondrial membrane and the return transfer of protons from the outer to the inner mitochondrial membrane. They also reduce the mitochondrial membrane potential in mammalian cells. The different UCPs have tissue-specific expression; this gene is primarily expressed in skeletal muscle. This genes protein product is postulated to protect mitochondria against lipid-induced oxidative stress. Expression levels of this gene increase when fatty acid supplies to mitochondria exceed their oxidation capacity and the protein enables the export of fatty acids from mitochondria. UCPs contain the three solcar protein domains typically found in MACPs. Two splice variants have been found for this gene. |
Conjugation : | HIS |
Form : | Liquid |
Purity : | >90% by SDS-PAGE |
Storage buffer : | Preservative: NoneConstituents: 1X PBS |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles. |
Sequences of amino acids : | GTLPNIMRNAIVNCAEVVTYDILKEKLLDYHLLT |
Gene Name | UCP3 uncoupling protein 3 (mitochondrial, proton carrier) [ Homo sapiens ] |
Official Symbol | UCP3 |
Synonyms | UCP3; uncoupling protein 3 (mitochondrial, proton carrier); mitochondrial uncoupling protein 3; SLC25A9; |
Gene ID | 7352 |
mRNA Refseq | NM_003356 |
Protein Refseq | NP_003347 |
MIM | 602044 |
Uniprot ID | P55916 |
Chromosome Location | 11q13.4 |
Pathway | Diurnally regulated genes with circadian orthologs, organism-specific biosystem; Electron Transport Chain, organism-specific biosystem; Energy Metabolism, organism-specific biosystem; Metabolism, organism-specific biosystem; Mitochondrial Uncoupling Proteins, organism-specific biosystem; |
Function | binding; oxidative phosphorylation uncoupler activity; transporter activity; |
◆ Cell & Tissue Lysates | ||
UCP3-524HCL | Recombinant Human UCP3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All UCP3 Products
Required fields are marked with *
My Review for All UCP3 Products
Required fields are marked with *