Recombinant Human UGP2 protein, His-SUMO-tagged
Cat.No. : | UGP2-4414H |
Product Overview : | Recombinant Human UGP2 protein(Q16851)(1-497aa), fused to N-terminal His-SUMO tag, was expressed in E. coli |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 1-497aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 71.7 kDa |
AA Sequence : | MSQDGASQFQEVIRQELELSVKKELEKILTTASSHEFEHTKKDLDGFRKLFHRFLQEKGPSVDWGKIQRPPEDSIQPYEKIKARGLPDNISSVLNKLVVVKLNGGLGTSMGCKGPKSLIGVRNENTFLDLTVQQIEHLNKTYNTDVPLVLMNSFNTDEDTKKILQKYNHCRVKIYTFNQSRYPRINKESLLPVAKDVSYSGENTEAWYPPGHGDIYASFYNSGLLDTFIGEGKEYIFVSNIDNLGATVDLYILNHLMNPPNGKRCEFVMEVTNKTRADVKGGTLTQYEGKLRLVEIAQVPKAHVDEFKSVSKFKIFNTNNLWISLAAVKRLQEQNAIDMEIIVNAKTLDGGLNVIQLETAVGAAIKSFENSLGINVPRSRFLPVKTTSDLLLVMSNLYSLNAGSLTMSEKREFPTVPLVKLGSSFTKVQDYLRRFESIPDMLELDHLTVSGDVTFGKNVSLKGTVIIIANHGDRIDIPPGAVLENKIVSGNLRILDH |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | UGP2 UDP-glucose pyrophosphorylase 2 [ Homo sapiens ] |
Official Symbol | UGP2 |
Synonyms | UGP2; UDP-glucose pyrophosphorylase 2; UDP glucose pyrophosphorylase 1 , UGP1; UTP--glucose-1-phosphate uridylyltransferase; UGPP1; UDPGP; UGPase 2; UDP-glucose diphosphorylase; UDP-glucose pyrophosphorylase 1; UTP-glucose-1-phosphate uridyltransferase; UTP--glucose-1-phosphate uridylyltransferase 2; uridyl diphosphate glucose pyrophosphorylase 2; UDPG; UGP1; UGPP2; UDPGP2; pHC379; |
Gene ID | 7360 |
mRNA Refseq | NM_001001521 |
Protein Refseq | NP_001001521 |
MIM | 191760 |
UniProt ID | Q16851 |
◆ Recombinant Proteins | ||
UGP2-788HFL | Recombinant Full Length Human UGP2 Protein, C-Flag-tagged | +Inquiry |
UGP2-2308H | Recombinant Human UGP2 Protein, His (Fc)-Avi-tagged | +Inquiry |
UGP2-9884M | Recombinant Mouse UGP2 Protein, His (Fc)-Avi-tagged | +Inquiry |
UGP2-31662TH | Recombinant Human UGP2 | +Inquiry |
UGP2-5687C | Recombinant Chicken UGP2 | +Inquiry |
◆ Cell & Tissue Lysates | ||
UGP2-514HCL | Recombinant Human UGP2 293 Cell Lysate | +Inquiry |
UGP2-515HCL | Recombinant Human UGP2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All UGP2 Products
Required fields are marked with *
My Review for All UGP2 Products
Required fields are marked with *
0
Inquiry Basket