Recombinant Human UGT1A9, GST-tagged
Cat.No. : | UGT1A9-12H |
Product Overview : | Recombinant Human UGT1A9(1 a.a. - 530 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a UDP-glucuronosyltransferase, an enzyme of the glucuronidation pathway that transforms small lipophilic molecules, such as steroids, bilirubin, hormones, and drugs, into water-soluble, excretable metabolites. This gene is part of a complex locus that encodes several UDP-glucuronosyltransferases. The locus includes thirteen unique alternate first exons followed by four common exons. Four of the alternate first exons are considered pseudogenes. Each of the remaining nine 5' exons may be spliced to the four common exons, resulting in nine proteins with different N-termini and identical C-termini. Each first exon encodes the substrate binding site, and is regulated by its own promoter. The enzyme encoded by this gene is active on phenols. |
Molecular Mass : | 86.3 kDa |
AA Sequence : | MACTGWTSPLPLCVCLLLTCGFAEAGKLLVVPMDGSHWFTMRSVVEKLILRGHEVVVVMPEVSWQLGRSLNCTVK TYSTSYTLEDLDREFKAFAHAQWKAQVRSIYSLLMGSYNDIFDLFFSNCRSLFKDKKLVEYLKESSFDAVFLDPF DNCGLIVAKYFSLPSVVFARGILCHYLEEGAQCPAPLSYVPRILLGFSDAMTFKERVRNHIMHLEEHLLCHRFFK NALEIASEILQTPVTEYDLYSHTSIWLLRTDFVLDYPKPVMPNMIFIGGINCHQGKPLPMEFEAYINASGEHGIV VFSLGSMVSEIPEKKAMAIADALGKIPQTVLWRYTGTRPSNLANNTILVKWLPQNDLLGHPMTRAFITHAGSHGV YESICNGVPMVMMPLFGDQMDNAKRMETKGAGVTLNVLEMTSEDLENALKAVINDKSYKENIMRLSSLHKDRPVE PLDLAVFWVEFVMRHKGAPHLRPAAHDLTWYQYHSLDVIGFLLAVVLTVAFITFKCCAYGYRKCLGKKGRVKKAH KSKTH |
Applications : | ELISA; WB-Re; AP; Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80ºC. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | UGT1A9 UDP glucuronosyltransferase 1 family, polypeptide A9 [ Homo sapiens (human) ] |
Official Symbol | UGT1A9 |
Synonyms | UGT1A9; UDP glucuronosyltransferase 1 family, polypeptide A9; LUGP4; UDPGT; UGT1I; HLUGP4; UGT-1I; UGT1-9; UGT1.9; UGT1AI; UGT1-09; UDPGT 1-9; UDP-glucuronosyltransferase 1-9; UDP glycosyltransferase 1 family, polypeptide A9; UDP-glucuronosyltransferase 1-I; UDP-glucuronosyltransferase 1A9; NP_066307.1; EC 2.4.1.17 |
Gene ID | 54600 |
mRNA Refseq | NM_021027 |
Protein Refseq | NP_066307 |
MIM | 606434 |
UniProt ID | O60656 |
Chromosome Location | 2q37 |
Pathway | Arylamine metabolism; Ascorbate and aldarate metabolism; Chemical carcinogenesis; Defective AHCY causes Hypermethioninemia with S-adenosylhomocysteine hydrolase deficiency (HMAHCHD) |
Function | enzyme binding; enzyme inhibitor activity; NOT glucuronosyltransferase activity; glucuronosyltransferase activity |
◆ Recombinant Proteins | ||
UGT1A9-821C | Recombinant Cynomolgus Monkey UGT1A9 Protein, His (Fc)-Avi-tagged | +Inquiry |
UGT1A9-01H | Recombinant Human UGT1A9 Protein, 6×His tagged | +Inquiry |
UGT1A9-9890M | Recombinant Mouse UGT1A9 Protein, His (Fc)-Avi-tagged | +Inquiry |
UGT1A9-100H | Active Recombinant Human UGT1A9 Protein | +Inquiry |
RFL12645MF | Recombinant Full Length Mouse Udp-Glucuronosyltransferase 1-9(Ugt1A9) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
UGT1A9-510HCL | Recombinant Human UGT1A9 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All UGT1A9 Products
Required fields are marked with *
My Review for All UGT1A9 Products
Required fields are marked with *
0
Inquiry Basket