Recombinant Human UHRF1

Cat.No. : UHRF1-31665TH
Product Overview : Recombinant fragment corresponding to aa 694-793 of human UHRF1 with a proprietary tag; 36.63kDa inclusive of tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 100 amino acids
Description : This gene encodes a member of a subfamily of RING-finger type E3 ubiquitin ligases. The protein binds to specific DNA sequences, and recruits a histone deacetylase to regulate gene expression. Its expression peaks at late G1 phase and continues during G2 and M phases of the cell cycle. It plays a major role in the G1/S transition by regulating topoisomerase IIalpha and retinoblastoma gene expression, and functions in the p53-dependent DNA damage checkpoint. Multiple transcript variants encoding different isoforms have been found for this gene.
Molecular Weight : 36.630kDa inclusive of tags
Tissue specificity : Expressed in thymus, bone marrow, testis, lung and heart. Overexpressed in breast cancer.
Biological activity : This product is useful for Antibody Production and Protein Array
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.79% Tris HCl, 0.31% GlutathioneNote: Glutathione is reduced.
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : WNEVLASLKDRPASGSPFQLFLSKVEETFQCICCQELVFRPITTVCQHNVCKDCLDRSFRAQVFSCPACRYDLGRSYAMQVNQPLQTVLNQLFPGYGNGR
Sequence Similarities : Contains 1 PHD-type zinc finger.Contains 2 RING-type zinc fingers.Contains 1 ubiquitin-like domain.Contains 1 YDG domain.
Gene Name UHRF1 ubiquitin-like with PHD and ring finger domains 1 [ Homo sapiens ]
Official Symbol UHRF1
Synonyms UHRF1; ubiquitin-like with PHD and ring finger domains 1; E3 ubiquitin-protein ligase UHRF1; FLJ21925; ICBP90; Np95; RNF106;
Gene ID 29128
mRNA Refseq NM_001048201
Protein Refseq NP_001041666
MIM 607990
Uniprot ID Q96T88
Chromosome Location 19p13.3
Function DNA binding; core promoter proximal region sequence-specific DNA binding; ligase activity; metal ion binding; methyl-CpG binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All UHRF1 Products

Required fields are marked with *

My Review for All UHRF1 Products

Required fields are marked with *

0
cart-icon