Recombinant Human UHRF1
Cat.No. : | UHRF1-31665TH |
Product Overview : | Recombinant fragment corresponding to aa 694-793 of human UHRF1 with a proprietary tag; 36.63kDa inclusive of tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 100 amino acids |
Description : | This gene encodes a member of a subfamily of RING-finger type E3 ubiquitin ligases. The protein binds to specific DNA sequences, and recruits a histone deacetylase to regulate gene expression. Its expression peaks at late G1 phase and continues during G2 and M phases of the cell cycle. It plays a major role in the G1/S transition by regulating topoisomerase IIalpha and retinoblastoma gene expression, and functions in the p53-dependent DNA damage checkpoint. Multiple transcript variants encoding different isoforms have been found for this gene. |
Molecular Weight : | 36.630kDa inclusive of tags |
Tissue specificity : | Expressed in thymus, bone marrow, testis, lung and heart. Overexpressed in breast cancer. |
Biological activity : | This product is useful for Antibody Production and Protein Array |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.79% Tris HCl, 0.31% GlutathioneNote: Glutathione is reduced. |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | WNEVLASLKDRPASGSPFQLFLSKVEETFQCICCQELVFRPITTVCQHNVCKDCLDRSFRAQVFSCPACRYDLGRSYAMQVNQPLQTVLNQLFPGYGNGR |
Sequence Similarities : | Contains 1 PHD-type zinc finger.Contains 2 RING-type zinc fingers.Contains 1 ubiquitin-like domain.Contains 1 YDG domain. |
Gene Name | UHRF1 ubiquitin-like with PHD and ring finger domains 1 [ Homo sapiens ] |
Official Symbol | UHRF1 |
Synonyms | UHRF1; ubiquitin-like with PHD and ring finger domains 1; E3 ubiquitin-protein ligase UHRF1; FLJ21925; ICBP90; Np95; RNF106; |
Gene ID | 29128 |
mRNA Refseq | NM_001048201 |
Protein Refseq | NP_001041666 |
MIM | 607990 |
Uniprot ID | Q96T88 |
Chromosome Location | 19p13.3 |
Function | DNA binding; core promoter proximal region sequence-specific DNA binding; ligase activity; metal ion binding; methyl-CpG binding; |
◆ Recombinant Proteins | ||
UHRF1-241H | Recombinant Human UHRF1 Protein, His-tagged | +Inquiry |
UHRF1-242H | Recombinant Human UHRF1 Protein, GST-tagged | +Inquiry |
UHRF1-12306Z | Recombinant Zebrafish UHRF1 | +Inquiry |
UHRF1-6439R | Recombinant Rat UHRF1 Protein | +Inquiry |
UHRF1-234H | Recombinant Human UHRF1 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
UHRF1-508HCL | Recombinant Human UHRF1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All UHRF1 Products
Required fields are marked with *
My Review for All UHRF1 Products
Required fields are marked with *