Recombinant Human UPB1, His-tagged

• Cat.No.: UPB1-49H
• Product Overview: Recombinant Human β-Ureidopropionase/UPB1 is produced by our E. coli expression system. The target protein is expressed with sequence (Met1-Glu384) of Human UPB1 fused with a His tag at the C-terminus.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 1-384 a.a.
• Description: β-Ureidopropionase is a cytoplasmic protein which belongs to the CN hydrolase family of BUP subfamily. β-Ureidopropionase binds one zinc ion per subunit, catalyzes the last step in the pyrimidine degradation pathway. β-Ureidopropionase can convert N-carbamyl-beta-aminoisobutyric acid and N-carbamyl-beta-alanine to beta-aminoisobutyric acid and beta-alanine, ammonia and carbon dioxide, respectively. The pyrimidine bases uracil and thymine are degraded via the consecutive action of dihydropyrimidine dehydrogenase (DHPDH), dihydropyrimidinase (DHP) and beta-ureidopropionase (UP) to beta-alanine and beta aminoisobutyric acid, respectively. Defects in β-Ureidopropionase are the cause of β-Ureidopropionase deficiency that is characterized by muscular hypotonia, dystonic movements, scoliosis, microcephaly and severe developmental delay.
• Form: Supplied as a 0.2 μM filtered solution of 20mM PB, 150mM NaCl, pH 7.4
• AA Sequence: MAGAEWKSLEECLEKHLPLPDLQEVKRVLYGKELRKLDLPREAFEAASREDFELQGYAFEAAEEQ LRRPRIVHVGLVQNRIPLPANAPVAEQVSALHRRIKAIVEVAAMCGVNIICFQEAWTMPFAFCTR EKLPWTEFAESAEDGPTTRFCQKLAKNHDMVVVSPILERDSEHGDVLWNTAVVISNSGAVLGKTR KNHIPRVGDFNESTYYMEGNLGHPVFQTQFGRIAVNICYGRHHPLNWLMYSINGAEIIFNPSATI GALSESLWPIEARNAAIANHCFTCAINRVGTEHFPNEFTSGDGKKAHQDFGYFYGSSYVAAPDSS RTPGLSRSRDGLLVAKLDLNLCQQVNDVWNFKMTGRYEMYARELAEAVKSNYSPTIVKEVEHHHH HH
• Endotoxin: Less than 0.1 ng/μg (1 IEU/μg).
• Purity: Greater than 95% as determined by reducing SDS-PAGE.
• Storage: Store at Please minimize freeze-thaw cycles.

Gene Information

• Gene Name: UPB1 ureidopropionase, beta [ Homo sapiens ]
• Official Symbol: UPB1
• Synonyms: UPB1; ureidopropionase, beta; beta-ureidopropionase; BUP1; BUP-1; beta-alanine synthase; n-carbamoyl-beta-alanine amidohydrolase
• Gene ID: 51733
• mRNA Refseq: NM_016327
• Protein Refseq: NP_057411
• MIM: 606673
• UniProt ID: Q9UBR1
• Chromosome Location: 22q11.2
• Pathway: Drug metabolism - other enzymes, organism-specific biosystem; Drug metabolism - other enzymes, conserved biosystem; Fluoropyrimidine Activity, organism-specific biosystem; Metabolic pathways, organism-specific biosystem; Metabolism, organism-specific biosystem; Metabolism of nucleotides, organism-specific biosystem; Pantothenate and CoA biosynthesis, organism-specific biosystem
• Function: beta-ureidopropionase activity; hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds; metal ion binding