Recombinant Human UPB1, His-tagged

Cat.No. : UPB1-49H
Product Overview : Recombinant Human β-Ureidopropionase/UPB1 is produced by our E. coli expression system. The target protein is expressed with sequence (Met1-Glu384) of Human UPB1 fused with a His tag at the C-terminus.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 1-384 a.a.
Description : β-Ureidopropionase is a cytoplasmic protein which belongs to the CN hydrolase family of BUP subfamily. β-Ureidopropionase binds one zinc ion per subunit, catalyzes the last step in the pyrimidine degradation pathway. β-Ureidopropionase can convert N-carbamyl-beta-aminoisobutyric acid and N-carbamyl-beta-alanine to beta-aminoisobutyric acid and beta-alanine, ammonia and carbon dioxide, respectively. The pyrimidine bases uracil and thymine are degraded via the consecutive action of dihydropyrimidine dehydrogenase (DHPDH), dihydropyrimidinase (DHP) and beta-ureidopropionase (UP) to beta-alanine and beta aminoisobutyric acid, respectively. Defects in β-Ureidopropionase are the cause of β-Ureidopropionase deficiency that is characterized by muscular hypotonia, dystonic movements, scoliosis, microcephaly and severe developmental delay.
Form : Supplied as a 0.2 μM filtered solution of 20mM PB, 150mM NaCl, pH 7.4
AA Sequence : MAGAEWKSLEECLEKHLPLPDLQEVKRVLYGKELRKLDLPREAFEAASREDFELQGYAFEAAEEQ LRRPRIVHVGLVQNRIPLPANAPVAEQVSALHRRIKAIVEVAAMCGVNIICFQEAWTMPFAFCTR EKLPWTEFAESAEDGPTTRFCQKLAKNHDMVVVSPILERDSEHGDVLWNTAVVISNSGAVLGKTR KNHIPRVGDFNESTYYMEGNLGHPVFQTQFGRIAVNICYGRHHPLNWLMYSINGAEIIFNPSATI GALSESLWPIEARNAAIANHCFTCAINRVGTEHFPNEFTSGDGKKAHQDFGYFYGSSYVAAPDSS RTPGLSRSRDGLLVAKLDLNLCQQVNDVWNFKMTGRYEMYARELAEAVKSNYSPTIVKEVEHHHH HH
Endotoxin : Less than 0.1 ng/μg (1 IEU/μg).
Purity : Greater than 95% as determined by reducing SDS-PAGE.
Storage : Store at Please minimize freeze-thaw cycles.
Gene Name UPB1 ureidopropionase, beta [ Homo sapiens ]
Official Symbol UPB1
Synonyms UPB1; ureidopropionase, beta; beta-ureidopropionase; BUP1; BUP-1; beta-alanine synthase; n-carbamoyl-beta-alanine amidohydrolase;
Gene ID 51733
mRNA Refseq NM_016327
Protein Refseq NP_057411
MIM 606673
UniProt ID Q9UBR1
Chromosome Location 22q11.2
Pathway Drug metabolism - other enzymes, organism-specific biosystem; Drug metabolism - other enzymes, conserved biosystem; Fluoropyrimidine Activity, organism-specific biosystem; Metabolic pathways, organism-specific biosystem; Metabolism, organism-specific biosystem; Metabolism of nucleotides, organism-specific biosystem; Pantothenate and CoA biosynthesis, organism-specific biosystem;
Function beta-ureidopropionase activity; hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds; metal ion binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All UPB1 Products

Required fields are marked with *

My Review for All UPB1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon