Recombinant Human UPB1, His-tagged
| Cat.No. : | UPB1-49H |
| Product Overview : | Recombinant Human β-Ureidopropionase/UPB1 is produced by our E. coli expression system. The target protein is expressed with sequence (Met1-Glu384) of Human UPB1 fused with a His tag at the C-terminus. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-384 a.a. |
| Description : | β-Ureidopropionase is a cytoplasmic protein which belongs to the CN hydrolase family of BUP subfamily. β-Ureidopropionase binds one zinc ion per subunit, catalyzes the last step in the pyrimidine degradation pathway. β-Ureidopropionase can convert N-carbamyl-beta-aminoisobutyric acid and N-carbamyl-beta-alanine to beta-aminoisobutyric acid and beta-alanine, ammonia and carbon dioxide, respectively. The pyrimidine bases uracil and thymine are degraded via the consecutive action of dihydropyrimidine dehydrogenase (DHPDH), dihydropyrimidinase (DHP) and beta-ureidopropionase (UP) to beta-alanine and beta aminoisobutyric acid, respectively. Defects in β-Ureidopropionase are the cause of β-Ureidopropionase deficiency that is characterized by muscular hypotonia, dystonic movements, scoliosis, microcephaly and severe developmental delay. |
| Form : | Supplied as a 0.2 μM filtered solution of 20mM PB, 150mM NaCl, pH 7.4 |
| AA Sequence : | MAGAEWKSLEECLEKHLPLPDLQEVKRVLYGKELRKLDLPREAFEAASREDFELQGYAFEAAEEQ LRRPRIVHVGLVQNRIPLPANAPVAEQVSALHRRIKAIVEVAAMCGVNIICFQEAWTMPFAFCTR EKLPWTEFAESAEDGPTTRFCQKLAKNHDMVVVSPILERDSEHGDVLWNTAVVISNSGAVLGKTR KNHIPRVGDFNESTYYMEGNLGHPVFQTQFGRIAVNICYGRHHPLNWLMYSINGAEIIFNPSATI GALSESLWPIEARNAAIANHCFTCAINRVGTEHFPNEFTSGDGKKAHQDFGYFYGSSYVAAPDSS RTPGLSRSRDGLLVAKLDLNLCQQVNDVWNFKMTGRYEMYARELAEAVKSNYSPTIVKEVEHHHH HH |
| Endotoxin : | Less than 0.1 ng/μg (1 IEU/μg). |
| Purity : | Greater than 95% as determined by reducing SDS-PAGE. |
| Storage : | Store at Please minimize freeze-thaw cycles. |
| Gene Name | UPB1 ureidopropionase, beta [ Homo sapiens ] |
| Official Symbol | UPB1 |
| Synonyms | UPB1; ureidopropionase, beta; beta-ureidopropionase; BUP1; BUP-1; beta-alanine synthase; n-carbamoyl-beta-alanine amidohydrolase; |
| Gene ID | 51733 |
| mRNA Refseq | NM_016327 |
| Protein Refseq | NP_057411 |
| MIM | 606673 |
| UniProt ID | Q9UBR1 |
| Chromosome Location | 22q11.2 |
| Pathway | Drug metabolism - other enzymes, organism-specific biosystem; Drug metabolism - other enzymes, conserved biosystem; Fluoropyrimidine Activity, organism-specific biosystem; Metabolic pathways, organism-specific biosystem; Metabolism, organism-specific biosystem; Metabolism of nucleotides, organism-specific biosystem; Pantothenate and CoA biosynthesis, organism-specific biosystem; |
| Function | beta-ureidopropionase activity; hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds; metal ion binding; |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All UPB1 Products
Required fields are marked with *
My Review for All UPB1 Products
Required fields are marked with *



