Recombinant Human UPB1, His-tagged
Cat.No. : | UPB1-49H |
Product Overview : | Recombinant Human β-Ureidopropionase/UPB1 is produced by our E. coli expression system. The target protein is expressed with sequence (Met1-Glu384) of Human UPB1 fused with a His tag at the C-terminus. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-384 a.a. |
Description : | β-Ureidopropionase is a cytoplasmic protein which belongs to the CN hydrolase family of BUP subfamily. β-Ureidopropionase binds one zinc ion per subunit, catalyzes the last step in the pyrimidine degradation pathway. β-Ureidopropionase can convert N-carbamyl-beta-aminoisobutyric acid and N-carbamyl-beta-alanine to beta-aminoisobutyric acid and beta-alanine, ammonia and carbon dioxide, respectively. The pyrimidine bases uracil and thymine are degraded via the consecutive action of dihydropyrimidine dehydrogenase (DHPDH), dihydropyrimidinase (DHP) and beta-ureidopropionase (UP) to beta-alanine and beta aminoisobutyric acid, respectively. Defects in β-Ureidopropionase are the cause of β-Ureidopropionase deficiency that is characterized by muscular hypotonia, dystonic movements, scoliosis, microcephaly and severe developmental delay. |
Form : | Supplied as a 0.2 μM filtered solution of 20mM PB, 150mM NaCl, pH 7.4 |
AA Sequence : | MAGAEWKSLEECLEKHLPLPDLQEVKRVLYGKELRKLDLPREAFEAASREDFELQGYAFEAAEEQ LRRPRIVHVGLVQNRIPLPANAPVAEQVSALHRRIKAIVEVAAMCGVNIICFQEAWTMPFAFCTR EKLPWTEFAESAEDGPTTRFCQKLAKNHDMVVVSPILERDSEHGDVLWNTAVVISNSGAVLGKTR KNHIPRVGDFNESTYYMEGNLGHPVFQTQFGRIAVNICYGRHHPLNWLMYSINGAEIIFNPSATI GALSESLWPIEARNAAIANHCFTCAINRVGTEHFPNEFTSGDGKKAHQDFGYFYGSSYVAAPDSS RTPGLSRSRDGLLVAKLDLNLCQQVNDVWNFKMTGRYEMYARELAEAVKSNYSPTIVKEVEHHHH HH |
Endotoxin : | Less than 0.1 ng/μg (1 IEU/μg). |
Purity : | Greater than 95% as determined by reducing SDS-PAGE. |
Storage : | Store at Please minimize freeze-thaw cycles. |
Gene Name | UPB1 ureidopropionase, beta [ Homo sapiens ] |
Official Symbol | UPB1 |
Synonyms | UPB1; ureidopropionase, beta; beta-ureidopropionase; BUP1; BUP-1; beta-alanine synthase; n-carbamoyl-beta-alanine amidohydrolase; |
Gene ID | 51733 |
mRNA Refseq | NM_016327 |
Protein Refseq | NP_057411 |
MIM | 606673 |
UniProt ID | Q9UBR1 |
Chromosome Location | 22q11.2 |
Pathway | Drug metabolism - other enzymes, organism-specific biosystem; Drug metabolism - other enzymes, conserved biosystem; Fluoropyrimidine Activity, organism-specific biosystem; Metabolic pathways, organism-specific biosystem; Metabolism, organism-specific biosystem; Metabolism of nucleotides, organism-specific biosystem; Pantothenate and CoA biosynthesis, organism-specific biosystem; |
Function | beta-ureidopropionase activity; hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds; metal ion binding; |
◆ Recombinant Proteins | ||
Upb1-7919M | Recombinant Mouse Upb1 protein, His & T7-tagged | +Inquiry |
Upb1-225M | Recombinant Mouse Upb1 Protein, MYC/DDK-tagged | +Inquiry |
UPB1-967H | Recombinant Human UPB1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
UPB1-49H | Recombinant Human UPB1, His-tagged | +Inquiry |
UPB1-5906H | Recombinant Human UPB1 Protein (Trp121-Glu384), N-His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
UPB1-495HCL | Recombinant Human UPB1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All UPB1 Products
Required fields are marked with *
My Review for All UPB1 Products
Required fields are marked with *