Recombinant Human UPF1, His-tagged

Cat.No. : UPF1-30951TH
Product Overview : Recombinant fragment, corresponding to amino acids 703-1118 of Human RENT1/hUPF1 with N terminal His tag; 416 amino acids, 67 kDa ;
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 703-1118 a.a.
Description : This gene encodes a protein that is part of a post-splicing multiprotein complex involved in both mRNA nuclear export and mRNA surveillance. mRNA surveillance detects exported mRNAs with truncated open reading frames and initiates nonsense-mediated mRNA decay (NMD). When translation ends upstream from the last exon-exon junction, this triggers NMD to degrade mRNAs containing premature stop codons. This protein is located only in the cytoplasm. When translation ends, it interacts with the protein that is a functional homolog of yeast Upf2p to trigger mRNA decapping. Use of multiple polyadenylation sites has been noted for this gene.
Conjugation : HIS
Tissue specificity : Ubiquitous.
Form : Lyophilised:Reconstitute with 69 μl distilled water.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : RMHPALSAFPSNIFYEGSLQNGVTAADRVKKGFDFQWPQP DKPMFFYVTQGQEEIASSGTSYLNRTEAANVEKITTKL LKAGAKPDQIGIITPYEGQRSYLVQYMQFSGSLHTKLY QEVEIASVDAFQGREKDFIILSCVRANEHQGIGFLNDPRRLNVALTRARYGVIIVGNPKALSKQPLWNHLLNYYKEQK VLVEGPLNNLRESLMQFSKPRKLVNTINPGARFMTTAM YDAREAIIPGSVYDRSSQGRPSSMYFQTHDQIGMISAG PSHVAAMNIPIPFNLVMPPMPPPGYFGQANGPAAGRGTPK GKTGRGGRQKNRFGLPGPSQTNLPNSQASQDVASQPFS QGALTQGYISMSQPSQMSQPGLSQPELSQDSYLGDEFK SQIDVALSQDSTYQGERAYQHGGVTGLSQY
Sequence Similarities : Belongs to the DNA2/NAM7 helicase family.Contains 1 C2H2-type zinc finger.
Gene Name UPF1 UPF1 regulator of nonsense transcripts homolog (yeast) [ Homo sapiens ]
Official Symbol UPF1
Synonyms UPF1; UPF1 regulator of nonsense transcripts homolog (yeast); regulator of nonsense transcripts 1 , RENT1; regulator of nonsense transcripts 1; HUPF1; KIAA0221; NORF1; pNORF1; smg 2; smg 2 homolog; nonsense mediated mRNA decay factor (C. elegans); UP Fram
Gene ID 5976
mRNA Refseq NM_002911
Protein Refseq NP_002902
MIM 601430
Uniprot ID Q92900
Chromosome Location 19p13.2-p13.11
Pathway Exon junction complex (EJC), organism-specific biosystem; Metabolism, organism-specific biosystem; Metabolism of RNA, organism-specific biosystem; Metabolism of mRNA, organism-specific biosystem; Nonsense Mediated Decay Enhanced by the Exon Junction Complex, organism-specific biosystem;
Function ATP binding; ATP-dependent RNA helicase activity; DNA binding; RNA binding; chromatin binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All UPF1 Products

Required fields are marked with *

My Review for All UPF1 Products

Required fields are marked with *

0
cart-icon