Recombinant Human UPF1, His-tagged
Cat.No. : | UPF1-30951TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 703-1118 of Human RENT1/hUPF1 with N terminal His tag; 416 amino acids, 67 kDa ; |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 703-1118 a.a. |
Description : | This gene encodes a protein that is part of a post-splicing multiprotein complex involved in both mRNA nuclear export and mRNA surveillance. mRNA surveillance detects exported mRNAs with truncated open reading frames and initiates nonsense-mediated mRNA decay (NMD). When translation ends upstream from the last exon-exon junction, this triggers NMD to degrade mRNAs containing premature stop codons. This protein is located only in the cytoplasm. When translation ends, it interacts with the protein that is a functional homolog of yeast Upf2p to trigger mRNA decapping. Use of multiple polyadenylation sites has been noted for this gene. |
Conjugation : | HIS |
Tissue specificity : | Ubiquitous. |
Form : | Lyophilised:Reconstitute with 69 μl distilled water. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | RMHPALSAFPSNIFYEGSLQNGVTAADRVKKGFDFQWPQP DKPMFFYVTQGQEEIASSGTSYLNRTEAANVEKITTKL LKAGAKPDQIGIITPYEGQRSYLVQYMQFSGSLHTKLY QEVEIASVDAFQGREKDFIILSCVRANEHQGIGFLNDPRRLNVALTRARYGVIIVGNPKALSKQPLWNHLLNYYKEQK VLVEGPLNNLRESLMQFSKPRKLVNTINPGARFMTTAM YDAREAIIPGSVYDRSSQGRPSSMYFQTHDQIGMISAG PSHVAAMNIPIPFNLVMPPMPPPGYFGQANGPAAGRGTPK GKTGRGGRQKNRFGLPGPSQTNLPNSQASQDVASQPFS QGALTQGYISMSQPSQMSQPGLSQPELSQDSYLGDEFK SQIDVALSQDSTYQGERAYQHGGVTGLSQY |
Sequence Similarities : | Belongs to the DNA2/NAM7 helicase family.Contains 1 C2H2-type zinc finger. |
Gene Name | UPF1 UPF1 regulator of nonsense transcripts homolog (yeast) [ Homo sapiens ] |
Official Symbol | UPF1 |
Synonyms | UPF1; UPF1 regulator of nonsense transcripts homolog (yeast); regulator of nonsense transcripts 1 , RENT1; regulator of nonsense transcripts 1; HUPF1; KIAA0221; NORF1; pNORF1; smg 2; smg 2 homolog; nonsense mediated mRNA decay factor (C. elegans); UP Fram |
Gene ID | 5976 |
mRNA Refseq | NM_002911 |
Protein Refseq | NP_002902 |
MIM | 601430 |
Uniprot ID | Q92900 |
Chromosome Location | 19p13.2-p13.11 |
Pathway | Exon junction complex (EJC), organism-specific biosystem; Metabolism, organism-specific biosystem; Metabolism of RNA, organism-specific biosystem; Metabolism of mRNA, organism-specific biosystem; Nonsense Mediated Decay Enhanced by the Exon Junction Complex, organism-specific biosystem; |
Function | ATP binding; ATP-dependent RNA helicase activity; DNA binding; RNA binding; chromatin binding; |
◆ Recombinant Proteins | ||
UPF1-30951TH | Recombinant Human UPF1, His-tagged | +Inquiry |
UPF1-9926M | Recombinant Mouse UPF1 Protein, His (Fc)-Avi-tagged | +Inquiry |
UPF1-12641Z | Recombinant Zebrafish UPF1 | +Inquiry |
UPF1-2318H | Recombinant Human UPF1 Protein, His (Fc)-Avi-tagged | +Inquiry |
UPF1-17861M | Recombinant Mouse UPF1 Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All UPF1 Products
Required fields are marked with *
My Review for All UPF1 Products
Required fields are marked with *