Recombinant Human UPF3B, His-tagged

Cat.No. : UPF3B-31673TH
Product Overview : Recombinant fragment, corresponding to amino acids 277-470 of Human UPF3B/RENT3B with N terminal His tag; Predicted MWt 24 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 277-470 a.a.
Description : This gene encodes a protein that is part of a post-splicing multiprotein complex involved in both mRNA nuclear export and mRNA surveillance. The encoded protein is one of two functional homologs to yeast Upf3p. mRNA surveillance detects exported mRNAs with truncated open reading frames and initiates nonsense-mediated mRNA decay (NMD). When translation ends upstream from the last exon-exon junction, this triggers NMD to degrade mRNAs containing premature stop codons. This protein binds to the mRNA and remains bound after nuclear export, acting as a nucleocytoplasmic shuttling protein. It forms with Y14 a complex that binds specifically 20 nt upstream of exon-exon junctions. This gene is located on the long arm of chromosome X. Two splice variants encoding different isoforms have been found for this gene.
Conjugation : HIS
Form : Lyophilised:Reconstitute with 98 μl aqua dest.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : GDEKELDKREKAKKLDKENLSDERASGQSCTLPKRSDSEL KDEKPKRPEDESGRDYREREREYERDQERILRERERLK RQEEERRRQKERYEKEKTFKRKEEEMKKEKDTLRDKGK KAESTESIGSSEKTEKKEEVVKRDRIRNKDRPAMQLYQ PGARSRNRLCPPDDSTKSGDSAAERKQESGISHRKEGGEE
Gene Name UPF3B UPF3 regulator of nonsense transcripts homolog B (yeast) [ Homo sapiens ]
Official Symbol UPF3B
Synonyms UPF3B; UPF3 regulator of nonsense transcripts homolog B (yeast); regulator of nonsense transcripts 3B; HUPF3B; RENT3B; UPF3X;
Gene ID 65109
mRNA Refseq NM_080632
Protein Refseq NP_542199
MIM 300298
Uniprot ID Q9BZI7
Chromosome Location Xq25-q26
Pathway Cleavage of Growing Transcript in the Termination Region, organism-specific biosystem; Exon junction complex (EJC), organism-specific biosystem; Formation and Maturation of mRNA Transcript, organism-specific biosystem; Gene Expression, organism-specific biosystem; Metabolism, organism-specific biosystem;
Function mRNA binding; nucleocytoplasmic transporter activity; nucleotide binding; protein binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All UPF3B Products

Required fields are marked with *

My Review for All UPF3B Products

Required fields are marked with *

0

Inquiry Basket

cartIcon