Recombinant Human UPK3A, His-tagged
Cat.No. : | UPK3A-31078TH |
Product Overview : | Recombinant fragment of Human Uroplakin III with an N terminal His tag; 214aa, 23.1kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 189 amino acids |
Description : | This gene encodes a member of the uroplakin family, a group of transmembrane proteins that form complexes on the apical surface of the bladder epithelium. Mutations in this gene may be associated with renal adysplasia. Alternatively spliced transcript variants have been described. |
Conjugation : | HIS |
Molecular Weight : | 23.100kDa inclusive of tags |
Tissue specificity : | Expressed in ureter. |
Form : | Liquid |
Purity : | >90% by SDS-PAGE |
Storage buffer : | pH: 8.00Constituents:0.32% Tris HCl, 0.03% DTT, 20% Glycerol, 0.88% Sodium chloride |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMGSHMVNLQPQLASVTFATN NPTLTTVALEKPLCMFDSKEALTGTHEVYLYVLVDSAISR NASVQDSTNTPLGSTFLQTEGGRTGPYKAVAFDLIPCSDL PSLDAIGDVSKASQILNAYLVRVGANGTCLWDPNFQGLCN PPLSAATEYRFKYVLVNMSTGLVEDQTLWSDPIRTNQLTP YSTIDTWPGRRSGG |
Sequence Similarities : | Belongs to the uroplakin-3 family. |
Gene Name | UPK3A uroplakin 3A [ Homo sapiens ] |
Official Symbol | UPK3A |
Synonyms | UPK3A; uroplakin 3A; UPK3, uroplakin 3; uroplakin-3a; |
Gene ID | 7380 |
mRNA Refseq | NM_001167574 |
Protein Refseq | NP_001161046 |
MIM | 611559 |
Uniprot ID | O75631 |
Chromosome Location | 22q13.31 |
◆ Recombinant Proteins | ||
UPK3A-6545H | Recombinant Human UPK3A Protein (Phe15-Ile211), His tagged | +Inquiry |
Upk3a-285R | Recombinant Rat Upk3a Protein, His-tagged | +Inquiry |
UPK3A-9928M | Recombinant Mouse UPK3A Protein, His (Fc)-Avi-tagged | +Inquiry |
UPK3A-229H | Recombinant Human Uroplakin 3A | +Inquiry |
UPK3A-2498M | Recombinant Mouse UPK3A Protein (19-207 aa), His-Myc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
UPK3A-724HCL | Recombinant Human UPK3A lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All UPK3A Products
Required fields are marked with *
My Review for All UPK3A Products
Required fields are marked with *
0
Inquiry Basket