Recombinant Human UPP2 Protein, Full Length, N-GST tagged

Cat.No. : UPP2-20HFL
Product Overview : Human UPP2 full-length ORF ( NP_775491.1, 1 a.a. - 317 a.a.) recombinant protein with GST-tag at N-terminal was expressed in Wheat Germ (in vitro).
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Protein Length : Full Length
Description : Catalyzes the reversible phosphorylytic cleavage of uridine and deoxyuridine to uracil and ribose- or deoxyribose-1-phosphate. The produced molecules are then utilized as carbon and energy sources or in the rescue of pyrimidine bases for nucleotide synthesis. Shows substrate specificity and accept uridine, deoxyuridine, and thymidine as well as the two pyrimidine nucleoside analogs 5-fluorouridine and 5-fluoro-2(')-deoxyuridine as substrates.
Molecular Mass : 61.9 kDa
AA Sequence : MASVIPASNRSMRSDRNTYVGKRFVHVKNPYLDLMDEDILYHLDLGTKTHNLPAMFGDVKFVCVGGSPNRMKAFALFMHKELGFEEAEEDIKDICAGTDRYCMYKTGPVLAISHGMGIPSISIMLHELIKLLHHARCCDVTIIRIGTSGGIGIAPGTVVITDIAVDSFFKPRFEQVILDNIVTRSTELDKELSEELFNCSKEIPNFPTLVGHTMCTYDFYEGQGRLDGALCSFSREKKLDYLKRAFKAGVRNIEMESTVFAAMCGLCGLKAAVVCVTLLDRLDCDQINLPHDVLVEYQQRPQLLISNFIRRRLGLCD
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name UPP2 uridine phosphorylase 2 [ Homo sapiens (human) ]
Official Symbol UPP2
Synonyms UPP2; uridine phosphorylase 2; UDRPASE2; UP2; UPASE2; UPase 2; urdPase 2; uridine phosphorylase-2; liver-specific uridine phosphorylase;
Gene ID 151531
mRNA Refseq NM_173355
Protein Refseq NP_775491
MIM 617340
UniProt ID O95045

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All UPP2 Products

Required fields are marked with *

My Review for All UPP2 Products

Required fields are marked with *

0
cart-icon
0
compare icon