Recombinant Human UPP2 Protein, Full Length, N-GST tagged
Cat.No. : | UPP2-20HFL |
Product Overview : | Human UPP2 full-length ORF ( NP_775491.1, 1 a.a. - 317 a.a.) recombinant protein with GST-tag at N-terminal was expressed in Wheat Germ (in vitro). |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Protein Length : | Full Length |
Description : | Catalyzes the reversible phosphorylytic cleavage of uridine and deoxyuridine to uracil and ribose- or deoxyribose-1-phosphate. The produced molecules are then utilized as carbon and energy sources or in the rescue of pyrimidine bases for nucleotide synthesis. Shows substrate specificity and accept uridine, deoxyuridine, and thymidine as well as the two pyrimidine nucleoside analogs 5-fluorouridine and 5-fluoro-2(')-deoxyuridine as substrates. |
Molecular Mass : | 61.9 kDa |
AA Sequence : | MASVIPASNRSMRSDRNTYVGKRFVHVKNPYLDLMDEDILYHLDLGTKTHNLPAMFGDVKFVCVGGSPNRMKAFALFMHKELGFEEAEEDIKDICAGTDRYCMYKTGPVLAISHGMGIPSISIMLHELIKLLHHARCCDVTIIRIGTSGGIGIAPGTVVITDIAVDSFFKPRFEQVILDNIVTRSTELDKELSEELFNCSKEIPNFPTLVGHTMCTYDFYEGQGRLDGALCSFSREKKLDYLKRAFKAGVRNIEMESTVFAAMCGLCGLKAAVVCVTLLDRLDCDQINLPHDVLVEYQQRPQLLISNFIRRRLGLCD |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | UPP2 uridine phosphorylase 2 [ Homo sapiens (human) ] |
Official Symbol | UPP2 |
Synonyms | UPP2; uridine phosphorylase 2; UDRPASE2; UP2; UPASE2; UPase 2; urdPase 2; uridine phosphorylase-2; liver-specific uridine phosphorylase; |
Gene ID | 151531 |
mRNA Refseq | NM_173355 |
Protein Refseq | NP_775491 |
MIM | 617340 |
UniProt ID | O95045 |
◆ Recombinant Proteins | ||
UPP2-3604H | Recombinant Human UPP2, GST-tagged | +Inquiry |
Upp2-1295M | Recombinant Mouse Upp2 protein, His & T7-tagged | +Inquiry |
Upp2-6849M | Recombinant Mouse Upp2 Protein, Myc/DDK-tagged | +Inquiry |
UPP2-20HFL | Recombinant Human UPP2 Protein, Full Length, N-GST tagged | +Inquiry |
UPP2-10493Z | Recombinant Zebrafish UPP2 | +Inquiry |
◆ Cell & Tissue Lysates | ||
UPP2-493HCL | Recombinant Human UPP2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All UPP2 Products
Required fields are marked with *
My Review for All UPP2 Products
Required fields are marked with *