Recombinant Human UQCR11 Protein (1-56 aa), GST-tagged
| Cat.No. : | UQCR11-1199H |
| Product Overview : | Recombinant Human UQCR11 Protein (1-56 aa) is produced by E. coli expression system. This protein is fused with a GST tag at the N-terminal. Research Area: Transport. Protein Description: Full Length. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 1-56 aa |
| Description : | This is a component of the ubiquinol-cytochrome c reductase complex (complex III or cytochrome b-c1 complex), which is part of the mitochondrial respiratory chain.This protein may be closely linked to the iron-sulfur protein in the complex and function as an iron-sulfur protein binding factor. |
| Form : | Tris-based buffer,50% glycerol |
| Molecular Mass : | 33.6 kDa |
| AA Sequence : | MVTRFLGPRYRELVKNWVPTAYTWGAVGAVGLVWATDWRLILDWVPYINGKFKKDN |
| Purity : | > 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
| Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. Please refer to it for detailed information. |
| Gene Name | UQCR11 ubiquinol-cytochrome c reductase, complex III subunit XI [ Homo sapiens (human) ] |
| Official Symbol | UQCR11 |
| Synonyms | UQCR; QCR10; 0710008D09Rik; |
| Gene ID | 10975 |
| mRNA Refseq | NM_006830 |
| Protein Refseq | NP_006821 |
| UniProt ID | O14957 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All UQCR11 Products
Required fields are marked with *
My Review for All UQCR11 Products
Required fields are marked with *
