Recombinant Human UQCR11 Protein (1-56 aa), GST-tagged
Cat.No. : | UQCR11-1199H |
Product Overview : | Recombinant Human UQCR11 Protein (1-56 aa) is produced by E. coli expression system. This protein is fused with a GST tag at the N-terminal. Research Area: Transport. Protein Description: Full Length. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-56 aa |
Description : | This is a component of the ubiquinol-cytochrome c reductase complex (complex III or cytochrome b-c1 complex), which is part of the mitochondrial respiratory chain.This protein may be closely linked to the iron-sulfur protein in the complex and function as an iron-sulfur protein binding factor. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 33.6 kDa |
AA Sequence : | MVTRFLGPRYRELVKNWVPTAYTWGAVGAVGLVWATDWRLILDWVPYINGKFKKDN |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. Please refer to it for detailed information. |
Gene Name | UQCR11 ubiquinol-cytochrome c reductase, complex III subunit XI [ Homo sapiens (human) ] |
Official Symbol | UQCR11 |
Synonyms | UQCR; QCR10; 0710008D09Rik; |
Gene ID | 10975 |
mRNA Refseq | NM_006830 |
Protein Refseq | NP_006821 |
UniProt ID | O14957 |
◆ Recombinant Proteins | ||
UQCR11-9933M | Recombinant Mouse UQCR11 Protein, His (Fc)-Avi-tagged | +Inquiry |
UQCR11-17876M | Recombinant Mouse UQCR11 Protein | +Inquiry |
UQCR11-7775Z | Recombinant Zebrafish UQCR11 | +Inquiry |
UQCR11-1199H | Recombinant Human UQCR11 Protein (1-56 aa), GST-tagged | +Inquiry |
UQCR11-4106C | Recombinant Chicken UQCR11 | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All UQCR11 Products
Required fields are marked with *
My Review for All UQCR11 Products
Required fields are marked with *
0
Inquiry Basket