Recombinant Human UQCR11 Protein (1-56 aa), GST-tagged

Cat.No. : UQCR11-1199H
Product Overview : Recombinant Human UQCR11 Protein (1-56 aa) is produced by E. coli expression system. This protein is fused with a GST tag at the N-terminal. Research Area: Transport. Protein Description: Full Length.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 1-56 aa
Description : This is a component of the ubiquinol-cytochrome c reductase complex (complex III or cytochrome b-c1 complex), which is part of the mitochondrial respiratory chain.This protein may be closely linked to the iron-sulfur protein in the complex and function as an iron-sulfur protein binding factor.
Form : Tris-based buffer,50% glycerol
Molecular Mass : 33.6 kDa
AA Sequence : MVTRFLGPRYRELVKNWVPTAYTWGAVGAVGLVWATDWRLILDWVPYINGKFKKDN
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA with reconstitution instruction is sent along with the products. Please refer to it for detailed information.
Gene Name UQCR11 ubiquinol-cytochrome c reductase, complex III subunit XI [ Homo sapiens (human) ]
Official Symbol UQCR11
Synonyms UQCR; QCR10; 0710008D09Rik;
Gene ID 10975
mRNA Refseq NM_006830
Protein Refseq NP_006821
UniProt ID O14957

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All UQCR11 Products

Required fields are marked with *

My Review for All UQCR11 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon