Recombinant Human UQCR11 Protein (1-56 aa), GST-tagged

• Cat.No.: UQCR11-1199H
• Product Overview: Recombinant Human UQCR11 Protein (1-56 aa) is produced by E. coli expression system. This protein is fused with a GST tag at the N-terminal. Research Area: Transport. Protein Description: Full Length.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 1-56 aa
• Description: This is a component of the ubiquinol-cytochrome c reductase complex (complex III or cytochrome b-c1 complex), which is part of the mitochondrial respiratory chain.This protein may be closely linked to the iron-sulfur protein in the complex and function as an iron-sulfur protein binding factor.
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 33.6 kDa
• AA Sequence: MVTRFLGPRYRELVKNWVPTAYTWGAVGAVGLVWATDWRLILDWVPYINGKFKKDN
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with reconstitution instruction is sent along with the products. Please refer to it for detailed information.

Gene Information

• Gene Name: UQCR11 ubiquinol-cytochrome c reductase, complex III subunit XI [ Homo sapiens (human) ]
• Official Symbol: UQCR11
• Synonyms: UQCR; QCR10; 0710008D09Rik
• Gene ID: 10975
• mRNA Refseq: NM_006830
• Protein Refseq: NP_006821
• UniProt ID: O14957