Recombinant Human UQCRB Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : UQCRB-4693H
Product Overview : UQCRB MS Standard C13 and N15-labeled recombinant protein (NP_006285) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : This gene encodes a subunit of the ubiquinol-cytochrome c oxidoreductase complex, which consists of one mitochondrial-encoded and 10 nuclear-encoded subunits. The protein encoded by this gene binds ubiquinone and participates in the transfer of electrons when ubiquinone is bound. This protein plays an important role in hypoxia-induced angiogenesis through mitochondrial reactive oxygen species-mediated signaling. Mutations in this gene are associated with mitochondrial complex III deficiency. Alternatively spliced transcript variants have been found for this gene. Related pseudogenes have been identified on chromosomes 1, 5 and X.
Molecular Mass : 13.5 kDa
AA Sequence : MAGKQAVSASGKWLDGIRKWYYNAAGFNKLGLMRDDTIYEDEDVKEAIRRLPENLYNDRMFRIKRALDLNLKHQILPKEQWTKYEEENFYLEPYLKEVIRERKEREEWAKKTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name UQCRB ubiquinol-cytochrome c reductase binding protein [ Homo sapiens (human) ]
Official Symbol UQCRB
Synonyms UQCRB; ubiquinol-cytochrome c reductase binding protein; QPC; QCR7; QP-C; UQBC; UQBP; UQPC; UQCR6; MC3DN3; cytochrome b-c1 complex subunit 7; complex III subunit 7; complex III subunit VII; mitochondrial ubiquinone-binding protein; ubiquinol-cytochrome c reductase complex 14 kDa protein; ubiquinol-cytochrome c reductase, complex III subunit VI; EC 7.1.1.8
Gene ID 7381
mRNA Refseq NM_006294
Protein Refseq NP_006285
MIM 191330
UniProt ID P14927

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All UQCRB Products

Required fields are marked with *

My Review for All UQCRB Products

Required fields are marked with *

0
cart-icon
0
compare icon