Recombinant Human UQCRB Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | UQCRB-4693H | 
| Product Overview : | UQCRB MS Standard C13 and N15-labeled recombinant protein (NP_006285) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. | 
- Specification
 - Gene Information
 - Related Products
 - Download
 
| Species : | Human | 
| Source : | HEK293 | 
| Tag : | DDK&Myc | 
| Description : | This gene encodes a subunit of the ubiquinol-cytochrome c oxidoreductase complex, which consists of one mitochondrial-encoded and 10 nuclear-encoded subunits. The protein encoded by this gene binds ubiquinone and participates in the transfer of electrons when ubiquinone is bound. This protein plays an important role in hypoxia-induced angiogenesis through mitochondrial reactive oxygen species-mediated signaling. Mutations in this gene are associated with mitochondrial complex III deficiency. Alternatively spliced transcript variants have been found for this gene. Related pseudogenes have been identified on chromosomes 1, 5 and X. | 
| Molecular Mass : | 13.5 kDa | 
| AA Sequence : | MAGKQAVSASGKWLDGIRKWYYNAAGFNKLGLMRDDTIYEDEDVKEAIRRLPENLYNDRMFRIKRALDLNLKHQILPKEQWTKYEEENFYLEPYLKEVIRERKEREEWAKKTRTRPLEQKLISEEDLAANDILDYKDDDDKV | 
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining | 
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. | 
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. | 
| Concentration : | 50 μg/mL as determined by BCA | 
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. | 
| Gene Name | UQCRB ubiquinol-cytochrome c reductase binding protein [ Homo sapiens (human) ] | 
| Official Symbol | UQCRB | 
| Synonyms | UQCRB; ubiquinol-cytochrome c reductase binding protein; QPC; QCR7; QP-C; UQBC; UQBP; UQPC; UQCR6; MC3DN3; cytochrome b-c1 complex subunit 7; complex III subunit 7; complex III subunit VII; mitochondrial ubiquinone-binding protein; ubiquinol-cytochrome c reductase complex 14 kDa protein; ubiquinol-cytochrome c reductase, complex III subunit VI; EC 7.1.1.8 | 
| Gene ID | 7381 | 
| mRNA Refseq | NM_006294 | 
| Protein Refseq | NP_006285 | 
| MIM | 191330 | 
| UniProt ID | P14927 | 
| ◆ Recombinant Proteins | ||
| UQCRB-3040Z | Recombinant Zebrafish UQCRB | +Inquiry | 
| UQCRB-4693H | Recombinant Human UQCRB Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry | 
| Uqcrb-7924R | Recombinant Rat Uqcrb protein, His & GST-tagged | +Inquiry | 
| Uqcrb-6852M | Recombinant Mouse Uqcrb Protein, Myc/DDK-tagged | +Inquiry | 
| UQCRB-5487H | Recombinant Human UQCRB Protein (Ala2-Lys111), N-His tagged | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| UQCRB-489HCL | Recombinant Human UQCRB 293 Cell Lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
 - Q&As (0)
 
Ask a Question for All UQCRB Products
Required fields are marked with *
My Review for All UQCRB Products
Required fields are marked with *
  
        
    
      
            