Recombinant Human UQCRFS1 protein, GST-tagged

Cat.No. : UQCRFS1-106H
Product Overview : Recombinant Human UQCRFS1(1 a.a. - 274 a.a.), fussed with GST at N-terminal, was expressed in Wheat Germ.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Protein Length : 1 a.a. - 274 a.a.
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 55.88 kDa
AA Sequence : MLSVAARSGPFAPVLSATSRGVAGALRPLVQATVPATPEQPVLDLKRPFLSRESLSGQAVRRPLVASVGLNVPAS VCYSHTDIKVPDFSEYRRLEVLDSTKSSRESSEARKGFSYLVTGVTTVGVAYAAKNAVTQFVSSMSASADVLALA KIEIKLSDIPEGKNMAFKWRGKPLFVRHRTQKEIEQEAAVELSQLRDPQHDLDRVKKPEWVILIGVCTHLGCVPI ANAGDFGGYYCPCHGSHYDASGRIRLGPAPLNLEVPTYEFTSDDMVIVG
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name UQCRFS1 ubiquinol-cytochrome c reductase, Rieske iron-sulfur polypeptide 1 [ Homo sapiens ]
Official Symbol UQCRFS1
Synonyms RIP1; RIS1; RISP; UQCR5; cytochrome b-c1 complex subunit Rieske, mitochondrial; Rieske iron-sulfur protein; complex III subunit 5; cytochrome b-c1 complex subunit 5; ubiquinol-cytochrome c reductase iron-sulfur subunit
Gene ID 7386
mRNA Refseq NM_006003
Protein Refseq NP_005994.2
MIM 191327
UniProt ID P47985
Chromosome Location 19q12
Pathway Alzheimer's disease, organism-specific biosystem; Cardiac muscle contraction, organism-specific biosystem; Cytochrome bc1 complex, organism-specific biosystem
Function 2 iron, 2 sulfur cluster binding; metal ion binding; protein complex binding

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All UQCRFS1 Products

Required fields are marked with *

My Review for All UQCRFS1 Products

Required fields are marked with *

0
cart-icon
0
compare icon