Recombinant Human UQCRFS1 protein, GST-tagged

• Cat.No.: UQCRFS1-106H
• Product Overview: Recombinant Human UQCRFS1(1 a.a. - 274 a.a.), fussed with GST at N-terminal, was expressed in Wheat Germ.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Protein Length: 1 a.a. - 274 a.a.
• Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 55.88 kDa
• AA Sequence: MLSVAARSGPFAPVLSATSRGVAGALRPLVQATVPATPEQPVLDLKRPFLSRESLSGQAVRRPLVASVGLNVPAS VCYSHTDIKVPDFSEYRRLEVLDSTKSSRESSEARKGFSYLVTGVTTVGVAYAAKNAVTQFVSSMSASADVLALA KIEIKLSDIPEGKNMAFKWRGKPLFVRHRTQKEIEQEAAVELSQLRDPQHDLDRVKKPEWVILIGVCTHLGCVPI ANAGDFGGYYCPCHGSHYDASGRIRLGPAPLNLEVPTYEFTSDDMVIVG
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.

Gene Information

• Gene Name: UQCRFS1 ubiquinol-cytochrome c reductase, Rieske iron-sulfur polypeptide 1 [ Homo sapiens ]
• Official Symbol: UQCRFS1
• Synonyms: RIP1; RIS1; RISP; UQCR5; cytochrome b-c1 complex subunit Rieske, mitochondrial; Rieske iron-sulfur protein; complex III subunit 5; cytochrome b-c1 complex subunit 5; ubiquinol-cytochrome c reductase iron-sulfur subunit
• Gene ID: 7386
• mRNA Refseq: NM_006003
• Protein Refseq: NP_005994.2
• MIM: 191327
• UniProt ID: P47985
• Chromosome Location: 19q12
• Pathway: Alzheimer's disease, organism-specific biosystem; Cardiac muscle contraction, organism-specific biosystem; Cytochrome bc1 complex, organism-specific biosystem
• Function: 2 iron, 2 sulfur cluster binding; metal ion binding; protein complex binding