Recombinant Human URM1, His-tagged
| Cat.No. : | URM1-31676TH |
| Product Overview : | Recombinant full length Human Urm1 with N terminal His tag; 121 amino acids with tag, MWt 13.5 kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 101 amino acids |
| Description : | Acts as a sulfur carrier required for 2-thiolation of mcm(5)S(2)U at tRNA wobble positions of tRNA(Lys), tRNA(Glu) and tRNA(Gln). Serves as sulfur donor in tRNA 2-thiolation reaction by thiocarboxylated (-COSH) at its C-terminus by MOCS3. |
| Conjugation : | HIS |
| Molecular Weight : | 13.500kDa inclusive of tags |
| Form : | Liquid |
| Purity : | >95% by SDS-PAGE |
| Storage buffer : | Preservative: NoneConstituents: 10% Glycerol, 20mM Tris HCl, 1mM DTT, pH 8.0 |
| Storage : | Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
| Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMAAPLSVEVEFGGGAELLFDGIKKHRVTLPGQEEPWDIRNLLIWIKKNLLKERPELFIQGDSVRPGILVLINDADWELLGELDYQLQDQDSVLFISTLHGG |
| Sequence Similarities : | Belongs to the URM1 family. |
| Gene Name | URM1 ubiquitin related modifier 1 [ Homo sapiens ] |
| Official Symbol | URM1 |
| Synonyms | URM1; ubiquitin related modifier 1; C9orf74, chromosome 9 open reading frame 74 , ubiquitin related modifier 1 homolog (S. cerevisiae); ubiquitin-related modifier 1 homolog; MGC2668; |
| Gene ID | 81605 |
| mRNA Refseq | NM_001135947 |
| Protein Refseq | NP_001129419 |
| MIM | 612693 |
| Uniprot ID | Q9BTM9 |
| Chromosome Location | 9q34.13 |
| Pathway | Sulfur relay system, organism-specific biosystem; Sulfur relay system, conserved biosystem; |
| Function | protein binding; contributes_to sulfurtransferase activity; |
| ◆ Recombinant Proteins | ||
| Urm1-6855M | Recombinant Mouse Urm1 Protein, Myc/DDK-tagged | +Inquiry |
| URM1-4929R | Recombinant Rhesus Macaque URM1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| URM1-301636H | Recombinant Human URM1 protein, GST-tagged | +Inquiry |
| URM1-1768C | Recombinant Chicken URM1 | +Inquiry |
| URM1-63H | Recombiant Hmuan Ubiquitin Related Modifier 1, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| URM1-485HCL | Recombinant Human URM1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All URM1 Products
Required fields are marked with *
My Review for All URM1 Products
Required fields are marked with *



