Recombinant Human URM1 protein, GST-tagged

Cat.No. : URM1-301636H
Product Overview : Recombinant Human URM1 (1-101 aa) protein, fused to GST tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : Met1-Gly101
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
AA Sequence : MAAPLSVEVEFGGGAELLFDGIKKHRVTLPGQEEPWDIRNLLIWIKKNLLKERPELFIQGDSVRPGILVLINDADWELLGELDYQLQDQDSVLFISTLHGG
Purity : 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Stability : Store for up to 12 months at -20°C to -80°C as lyophilized powder.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Gene Name URM1 ubiquitin related modifier 1 [ Homo sapiens ]
Official Symbol URM1
Synonyms URM1; ubiquitin related modifier 1; C9orf74, chromosome 9 open reading frame 74 , ubiquitin related modifier 1 homolog (S. cerevisiae); ubiquitin-related modifier 1 homolog; MGC2668; ubiquitin related modifier 1 homolog; C9orf74; RP11-339B21.4;
Gene ID 81605
mRNA Refseq NM_001135947
Protein Refseq NP_001129419
MIM 612693
UniProt ID Q9BTM9

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All URM1 Products

Required fields are marked with *

My Review for All URM1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon