Recombinant Human URM1 protein, GST-tagged
Cat.No. : | URM1-301636H |
Product Overview : | Recombinant Human URM1 (1-101 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | Met1-Gly101 |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | MAAPLSVEVEFGGGAELLFDGIKKHRVTLPGQEEPWDIRNLLIWIKKNLLKERPELFIQGDSVRPGILVLINDADWELLGELDYQLQDQDSVLFISTLHGG |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Gene Name | URM1 ubiquitin related modifier 1 [ Homo sapiens ] |
Official Symbol | URM1 |
Synonyms | URM1; ubiquitin related modifier 1; C9orf74, chromosome 9 open reading frame 74 , ubiquitin related modifier 1 homolog (S. cerevisiae); ubiquitin-related modifier 1 homolog; MGC2668; ubiquitin related modifier 1 homolog; C9orf74; RP11-339B21.4; |
Gene ID | 81605 |
mRNA Refseq | NM_001135947 |
Protein Refseq | NP_001129419 |
MIM | 612693 |
UniProt ID | Q9BTM9 |
◆ Recombinant Proteins | ||
URM1-298H | Recombinant Human URM1 Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
URM1-5116R | Recombinant Rhesus monkey URM1 Protein, His-tagged | +Inquiry |
URM1-17885M | Recombinant Mouse URM1 Protein | +Inquiry |
Urm1-6855M | Recombinant Mouse Urm1 Protein, Myc/DDK-tagged | +Inquiry |
URM1-301636H | Recombinant Human URM1 protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
URM1-485HCL | Recombinant Human URM1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All URM1 Products
Required fields are marked with *
My Review for All URM1 Products
Required fields are marked with *
0
Inquiry Basket