Recombinant Human UROD protein, GST-tagged
Cat.No. : | UROD-3608H |
Product Overview : | Recombinant Human UROD protein(1-367 aa), fused with N-terminal GST tag, was expressed in E. coli. |
Availability | September 15, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-367 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
AA Sequence : | MEANGLGPQGFPELKNDTFLRAAWGEETDYTPVWCMRQAGRYLPEFRETRAAQDFFSTCRSPEACCELTLQPLRRFPLDAAIIFSDILVVPQALGMEVTMVPGKGPSFPEPLREEQDLERLRDPEVVASELGYVFQAITLTRQRLAGRVPLIGFAGAPWTLMTYMVEGGGSSTMAQAKRWLYQRPQASHQLLRILTDALVPYLVGQVVAGAQALQLFESHAGHLGPQLFNKFALPYIRDVAKQVKARLREAGLAPVPMIIFAKDGHFALEELAQAGYEVVGLDWTVAPKKARECVGKTVTLQVNLDPCALYASEEEIGQLVKQMLDDFGPHRYIANLGHGLYPDMDPEHVGAFVDAVHKHSRLLRQN |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Official Symbol | UROD |
Synonyms | UROD; uroporphyrinogen decarboxylase; uroporphyrinogen III decarboxylase; PCT; UPD; |
Gene ID | 7389 |
mRNA Refseq | NM_000374 |
Protein Refseq | NP_000365 |
MIM | 613521 |
UniProt ID | P06132 |
◆ Recombinant Proteins | ||
UROD-3332H | Recombinant Human UROD protein, His-GST-tagged | +Inquiry |
UROD-17887M | Recombinant Mouse UROD Protein | +Inquiry |
Urod-540M | Recombinant Mouse Urod Protein, His-tagged | +Inquiry |
Urod-6857M | Recombinant Mouse Urod Protein, Myc/DDK-tagged | +Inquiry |
UROD-0238H | Recombinant Human UROD Protein (M1-N367), His/Strep tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
UROD-483HCL | Recombinant Human UROD 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All UROD Products
Required fields are marked with *
My Review for All UROD Products
Required fields are marked with *