Recombinant Human UROD protein, GST-tagged
| Cat.No. : | UROD-3608H |
| Product Overview : | Recombinant Human UROD protein(1-367 aa), fused with N-terminal GST tag, was expressed in E. coli. |
| Availability | June 02, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 1-367 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| AA Sequence : | MEANGLGPQGFPELKNDTFLRAAWGEETDYTPVWCMRQAGRYLPEFRETRAAQDFFSTCRSPEACCELTLQPLRRFPLDAAIIFSDILVVPQALGMEVTMVPGKGPSFPEPLREEQDLERLRDPEVVASELGYVFQAITLTRQRLAGRVPLIGFAGAPWTLMTYMVEGGGSSTMAQAKRWLYQRPQASHQLLRILTDALVPYLVGQVVAGAQALQLFESHAGHLGPQLFNKFALPYIRDVAKQVKARLREAGLAPVPMIIFAKDGHFALEELAQAGYEVVGLDWTVAPKKARECVGKTVTLQVNLDPCALYASEEEIGQLVKQMLDDFGPHRYIANLGHGLYPDMDPEHVGAFVDAVHKHSRLLRQN |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Official Symbol | UROD |
| Synonyms | UROD; uroporphyrinogen decarboxylase; uroporphyrinogen III decarboxylase; PCT; UPD; |
| Gene ID | 7389 |
| mRNA Refseq | NM_000374 |
| Protein Refseq | NP_000365 |
| MIM | 613521 |
| UniProt ID | P06132 |
| ◆ Recombinant Proteins | ||
| UROD-9939M | Recombinant Mouse UROD Protein, His (Fc)-Avi-tagged | +Inquiry |
| Urod-6857M | Recombinant Mouse Urod Protein, Myc/DDK-tagged | +Inquiry |
| UROD-621H | Recombinant Human UROD Protein, His-tagged | +Inquiry |
| UROD-0239H | Recombinant Human UROD Protein (M1-N367), Tag Free | +Inquiry |
| UROD-1753H | Recombinant Human UROD protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| UROD-483HCL | Recombinant Human UROD 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All UROD Products
Required fields are marked with *
My Review for All UROD Products
Required fields are marked with *
