"USP3" Related Products

Expand

Recombinant Human USP3 protein, T7/His-tagged

Cat.No.: USP3-159H
Product Overview: Recombinant human USP3 cDNA (519 aa, Isoform-1, derived from BC065300) fused with T7-His-TEV cleavage site Tag at N-terminal was expressed in E. coli.
Source: E. coli
Species: Human
Tag: T7/His
Form: 0.1 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT.
AA Sequence: MASMTGGQQMGRGHHHHHHENLYFQGEGSECPHLSSSVCIAPDSAKFPNGSPSSWCCSVCRSNKSPWVCLTCSSV HCGRYVNGHAKKHYEDAQVPLTNHKKSEKQDKVQHTVCMDCSSYSTYCYRCDDFVVNDTKLGLVQKVREHLQNLE NSAFTADRHKKRKLLENSTLNSKLLKVNGSTTAICATGLRNLGNTCFMNAILQSLSNIEQFCCYFKELPAVELRN GKTAGRRTYHTRSQGDNNVSLVEEFRKTLCALWQGSQTAFSPESLFYVVWKIMPNFRGYQQQDAHEFMRYLLDHL HLELQGGFNGVSRSAILQENSTLSASNKCCINGASTVVTAIFGGILQNEVNCLICGTESRKFDPFLDLSLDIPSQ FRSKRSKNQENGPVCSLRDCLRSFTDLEELDETELYMCHKCKKKQKSTKKFWIQKLPKVLCLHLKRFHWTAYLRN KVDTYVEFPLRGLDMKCYLLEPENSGPESCLYDLAAVVVHHGSGVGSGHYTAYATHEGRWFHFNDSTVTLTDEET VVKAKAYILFYVEHQAKAGSDKL
Purity: >90% by SDS-PAGE
Storage: Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days.
Gene Name: USP3 ubiquitin specific peptidase 3 [ Homo sapiens ]
Official Symbol: USP3
Synonyms: USP3; ubiquitin specific peptidase 3; ubiquitin specific protease 3; ubiquitin carboxyl-terminal hydrolase 3; ubiquitin thioesterase 3; deubiquitinating enzyme 3; ubiquitin thiolesterase 3; ubiquitin-specific-processing protease 3; UBP; SIH003; MGC129878; MGC129879;
Gene ID: 9960
mRNA Refseq: NM_001256702
Protein Refseq: NP_001243631
MIM: 604728
UniProt ID: Q9Y6I4
Chromosome Location: 15q22.3
Function: cysteine-type peptidase activity; histone binding; metal ion binding; peptidase activity; ubiquitin thiolesterase activity; ubiquitin thiolesterase activity; ubiquitin-specific protease activity; zinc ion binding;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.