Recombinant Human USP3 protein, T7/His-tagged
Cat.No. : | USP3-159H |
Product Overview : | Recombinant human USP3 cDNA (519 aa, Isoform-1, derived from BC065300) fused with T7-His-TEV cleavage site Tag at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&T7 |
Protein Length : | 519 a.a. |
Form : | 0.1 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT. |
AA Sequence : | MASMTGGQQMGRGHHHHHHENLYFQGEGSECPHLSSSVCIAPDSAKFPNGSPSSWCCSVCRSNKSPWVCLTCSSV HCGRYVNGHAKKHYEDAQVPLTNHKKSEKQDKVQHTVCMDCSSYSTYCYRCDDFVVNDTKLGLVQKVREHLQNLE NSAFTADRHKKRKLLENSTLNSKLLKVNGSTTAICATGLRNLGNTCFMNAILQSLSNIEQFCCYFKELPAVELRN GKTAGRRTYHTRSQGDNNVSLVEEFRKTLCALWQGSQTAFSPESLFYVVWKIMPNFRGYQQQDAHEFMRYLLDHL HLELQGGFNGVSRSAILQENSTLSASNKCCINGASTVVTAIFGGILQNEVNCLICGTESRKFDPFLDLSLDIPSQ FRSKRSKNQENGPVCSLRDCLRSFTDLEELDETELYMCHKCKKKQKSTKKFWIQKLPKVLCLHLKRFHWTAYLRN KVDTYVEFPLRGLDMKCYLLEPENSGPESCLYDLAAVVVHHGSGVGSGHYTAYATHEGRWFHFNDSTVTLTDEET VVKAKAYILFYVEHQAKAGSDKL |
Purity : | >90% by SDS-PAGE |
Storage : | Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days. |
Gene Name | USP3 ubiquitin specific peptidase 3 [ Homo sapiens ] |
Official Symbol | USP3 |
Synonyms | USP3; ubiquitin specific peptidase 3; ubiquitin specific protease 3; ubiquitin carboxyl-terminal hydrolase 3; ubiquitin thioesterase 3; deubiquitinating enzyme 3; ubiquitin thiolesterase 3; ubiquitin-specific-processing protease 3; UBP; SIH003; MGC129878; MGC129879; |
Gene ID | 9960 |
mRNA Refseq | NM_001256702 |
Protein Refseq | NP_001243631 |
MIM | 604728 |
UniProt ID | Q9Y6I4 |
Chromosome Location | 15q22.3 |
Function | cysteine-type peptidase activity; histone binding; metal ion binding; peptidase activity; ubiquitin thiolesterase activity; ubiquitin thiolesterase activity; ubiquitin-specific protease activity; zinc ion binding; |
◆ Recombinant Proteins | ||
USP3-17919M | Recombinant Mouse USP3 Protein | +Inquiry |
USP3-2633H | Recombinant Human USP3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
USP3-5125R | Recombinant Rhesus monkey USP3 Protein, His-tagged | +Inquiry |
USP3-2326H | Recombinant Human USP3 Protein, His (Fc)-Avi-tagged | +Inquiry |
USP3-3625H | Recombinant Human USP3, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
USP3-462HCL | Recombinant Human USP3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All USP3 Products
Required fields are marked with *
My Review for All USP3 Products
Required fields are marked with *