Recombinant Human USP31, GST-tagged
Cat.No. : | USP31-710H |
Product Overview : | Recombinant Human USP31 (1254 aa - 1352 aa) fused with GST-tag at N-terminal, was expressed in vitro wheat germ system. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene is a member of the Ig superfamily and encodes a cell surface sialoglycoprotein expressed by cytokine-activated endothelium. This type I membrane protein mediates leukocyte-endothelial cell adhesion and signal transduction, and may play a role in the development of artherosclerosis and rheumatoid arthritis. Three alternatively spliced transcripts encoding different isoforms have been described for this gene. |
Molecular Mass : | 36.63 kDa |
Sequence : | AGGSSVKSVCKNTGDDEAERGHQPPASQQPNANTTGKEQLVTKDPASAKHSLLSARKSKSSQLDSGVPSSPGGRQSAEKSSKKLSSSMQTSARPSQKPQ |
Purification : | Glutathione Sepharose 4 Fast Flow |
Storage buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer. |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Storage : | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
Note : | Best use within three months from the date of receipt of this protein. |
OfficialSymbol : | USP31 |
Gene Name | USP31 ubiquitin specific peptidase 31 [ Homo sapiens ] |
Synonyms | ubiquitin specific peptidase 31; ubiquitin carboxyl-terminal hydrolase 31; KIAA1203; ubiquitin specific proteinase 31; ubiquitin specific protease 31; ubiquitin thioesterase 31; Deubiquitinating enzyme 31; EC 3.4.19.12; Ubiquitin thiolesterase 31; EC 3.1.2.15; Ubiquitin-specific-processing protease 31; OTTHUMP00000120022 |
Gene ID | 57478 |
mRNA Refseq | NM_020718 |
Protein Refseq | NP_065769 |
UniProt ID | Q70CQ4 |
Chromosome Location | 16p12.2 |
Function | cysteine-type peptidase activity; peptidase activity; ubiquitin thiolesterase activity |
◆ Recombinant Proteins | ||
USP31-710H | Recombinant Human USP31, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All USP31 Products
Required fields are marked with *
My Review for All USP31 Products
Required fields are marked with *
0
Inquiry Basket